The URL can be used to link to this page

Home My WebLink AboutAppendix G - Phase I Environmental Site Asessment Environmental Health & Safety | Due Diligence & Remediation Management | Construction Services Making a better future for all the communities we touch. www.HillmannConsulting.com 3+$6(,(19,5210(17$/6,7($66(660(17 9DOOH\%RXOHYDUG)RQWDQD&DOLIRUQLD3UHSDUHG)RU5LYHUVLGH)RQWDQD//& FR(3'6ROXWLRQV0DLQ6WUHHW6XLWH,UYLQH&DOLIRUQLD 0DUFK +LOOPDQQ3URMHFW1XPEHU& Environmental Health & Safety | Due Diligence & Remediation Management | Construction Services Making a better future for all the communities we touch. www.HillmannConsulting.com 0DUFK 0U-LP3LQHV(3'6ROXWLRQV0DLQ6WUHHW6XLWH,UYLQH&DOLIRUQLD RE:Phase I Environmental Site Assessment 9DOOH\%RXOHYDUG)RQWDQD&DOLIRUQLD+LOOPDQQ3URMHFW1R& 'HDU0U3LQHV+LOOPDQQ&RQVXOWLQJ//&KDVFRPSOHWHGD3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQWRIWKHDERYHUHIHUHQFHGSURSHUW\7KLVDVVHVVPHQWZDVSHUIRUPHGLQFRQIRUPDQFHZLWKRXUFRQWUDFWDJUHHPHQW DQGWKHVFRSHDQGOLPLWDWLRQVRI$6703UDFWLFH(ZKLFKLVWKHODWHVWYHUVLRQRIWKH (VWDQGDUGSXEOLVKHGE\WKH$670:HDSSUHFLDWHWKHRSSRUWXQLW\WRSURYLGHHQYLURQPHQWDOGXHGLOLJHQFHVHUYLFHV,I\RXKDYHDQ\TXHVWLRQVFRQFHUQLQJWKLVUHSRUWRULIZHFDQDVVLVW\RXLQDQ\RWKHUPDWWHUSOHDVHFRQWDFWRXU RIILFHDW 6LQFHUHO\+LOOPDQQ&RQVXOWLQJ//& *DEULHOD&\UXOLN5\DQ7HUZLOOLJHU3URMHFW0DQDJHU:HVWHUQ2SHUDWLRQV0DQDJHU Hillmann Consulting LLC Phase I Environmental Site Assessment -i- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California TABLE OF CONTENTS 1.0 FINDINGS, OPINIONS, AND CONCLUSIONS ........................................................................ 1 6XPPDU\RI3URMHFW'HWDLOV )LQGLQJV6XPPDU\7DEOH )LQGLQJV2SLQLRQVDQG&RQFOXVLRQV %XVLQHVV(QYLURQPHQWDO5LVNV1RQ$6706FRSH 2.0 INTRODUCTION .......................................................................................................................... 6 3XUSRVHDQG6FRSH 3URSHUW\/RFDWLRQ/HJDO'HVFULSWLRQ 'DWD*DSV (6$5HSRUW&RPSRQHQW'DWHV9LDELOLW\ 8VHU5HOLDQFH 6LJQLILFDQW$VVXPSWLRQV *HQHUDO/LPLWDWLRQVDQG([FHSWLRQV 3.0 USER PROVIDED INFORMATION ........................................................................................ 13 (QYLURQPHQWDO/LHQDQG$FWLYLW\DQG8VH/LPLWDWLRQ$8/6HDUFK 3ULRU(QYLURQPHQWDO5HSRUWV'RFXPHQWDWLRQ 8VHU5HVSRQVLELOLWLHV 8VHU¶V5HDVRQIRU3HUIRUPLQJ3KDVH,(6$ 4.0 RECORDS REVIEW ................................................................................................................... 15 (QYLURQPHQWDO,QIRUPDWLRQ +LVWRULFDO5HVHDUFK 5.0 INTERVIEWS .............................................................................................................................. 26 ,QWHUYLHZVZLWK2ZQHUV2SHUDWRUVDQG2FFXSDQWV ,QWHUYLHZVZLWK6WDWHDQGRU/RFDO*RYHUQPHQW2IILFLDOV 6.0 SITE RECONNAISSANCE ........................................................................................................ 28 0HWKRGRORJ\DQG/LPLWLQJ&RQGLWLRQV *HQHUDO6LWH6HWWLQJ RUSH TRUCK CENTERS - FONTANA USED TRUCKS .................................................................. 29 6LWH)HDWXUHVDQG&RQGLWLRQV 7.0 BUSINESS ENVIRONMENTAL RISKS .................................................................................. 32 $VEHVWRV&RQWDLQLQJ0DWHULDO$&0 /HDG%DVHG3DLQW 5DGRQ 0ROG0LFURELDO'DPDJH 1:,0DSSHG:HWODQGV /HDGLQ'ULQNLQJ:DWHU 8.0 REFERENCES ............................................................................................................................. 34 9.0 APPENDICES .............................................................................................................................. 35 $SSHQGL[$6LWH'LDJUDP9LFLQLW\0DS$SSHQGL[%6LWH3KRWRJUDSKV$SSHQGL[&4XHVWLRQQDLUHV8VHU3URYLGHG,QIRUPDWLRQ$SSHQGL['+LVWRULFDO5HFRUGV'RFXPHQWDWLRQ$SSHQGL[(5HJXODWRU\5HFRUGV'RFXPHQWDWLRQ$SSHQGL[)2WKHU'RFXPHQWV/DE5HVXOWV$SSHQGL[*3URMHFW3HUVRQQHO4XDOLILFDWLRQV Hillmann Consulting LLC Phase I Environmental Site Assessment -ii- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California List of Abbreviations/Acronyms +LOOPDQQPD\XVHWKHIROORZLQJDEEUHYLDWLRQVDQGDFURQ\PVIRUFRPPRQWHUPLQRORJ\GHVFULEHGLQRXUUHSRUW1RWDOODEEUHYLDWLRQVRUDFURQ\PVPD\EHDSSOLFDEOHWRWKLVUHSRUW$&0±$VEHVWRV&RQWDLQLQJ0DWHULDOVKRXOG$VEHVWRV&RQWDLQLQJEHK\SKHQDWHGOLNH/HDG%DVHG3DLQW"$2&±$UHDRI&RQFHUQ$67±$ERYHJURXQG6WRUDJH7DQN$670±$PHULFDQ6RFLHW\IRU7HVWLQJ0DWHULDOV%(5±%XVLQHVV(QYLURQPHQWDO5LVN&($±&ODVVLILFDWLRQ([FHSWLRQ$UHD&(5&/$±&RPSUHKHQVLYH(QYLURQPHQWDO5HVSRQVH&RPSHQVDWLRQDQG/LDELOLW\$FW&(5&/,6±&RPSUHKHQVLYH(QYLURQPHQWDO5HVSRQVH&RPSHQVDWLRQDQG/LDELOLW\,QIRUPDWLRQ6\VWHP&(64*±&RQGLWLRQDOO\([HPSW6PDOO4XDQWLW\*HQHUDWRU&2&±&KHPLFDOVRI&RQFHUQ&255$&76±&RUUHFWLYH$FWLRQ6LWHV&5(&±&RQWUROOHG5HFRJQL]HG(QYLURQPHQWDO&RQGLWLRQ'(&±'HSDUWPHQWRI(QYLURQPHQWDO&RQVHUYDWLRQ'(3±'HSDUWPHQWRI(QYLURQPHQWDO3URWHFWLRQ'+6±'HSDUWPHQWRI+HDOWK6HUYLFHV'13/±'HOLVWHG1DWLRQDO3ULRULW\/LVW'2%±'HSDUWPHQWRI%XLOGLQJV'2+±'HSDUWPHQWRI+HDOWK'27±'HSDUWPHQWRI7UDQVSRUWDWLRQ'76&±'HSDUWPHQWRI7R[LF6XEVWDQFHV&RQWURO(1*±(QJLQHHULQJ(3$±(QYLURQPHQWDO3URWHFWLRQ$JHQF\(516±(PHUJHQF\5HVSRQVH1RWLILFDWLRQ6\VWHP)'±)LUH'HSDUWPHQW)2,)2,$)2,/±)UHHGRPRI,QIRUPDWLRQ)UHHGRPRI,QIRUPDWLRQ$FW)UHHGRPRI,QIRUPDWLRQ/HWWHU+9$&±+HDWLQJ9HQWLODWLRQ $LU&RQGLWLRQLQJ+5(&±+LVWRULF5HFRJQL]HG(QYLURQPHQWDO&RQGLWLRQ,$4±,QGRRU$LU4XDOLW\,65$±,QGXVWULDO6LWH5HFRYHU\$FW/%3±/HDG%DVHG3DLQW/&3±/HDG&RQWDLQLQJ3DLQW/4*±/DUJH4XDQWLW\*HQHUDWRU/7$1.±/HDNLQJ6WRUDJH7DQN/867±/HDNLQJ8QGHUJURXQG6WRUDJH7DQN6'606'6±6DIHW\'DWD6KHHW0DWHULDO6DIHW\'DWD6KHHW1$±1RW$SSOLFDEOH1)$±1R)XUWKHU$FWLRQ1)5$3±1R)XUWKHU5HPHGLDO$FWLRQV3ODQQHG13'(6±1DWLRQDO3ROOXWDQW'LVFKDUJH(OLPLQDWLRQ6\VWHP13/±1DWLRQDO3ULRULW\/LVW2(5±2IILFHRI(QYLURQPHQWDO5HPHGLDWLRQ235$±2SHQ3XEOLF5HFRUGV$FW3$+±3RO\F\FOLF$URPDWLF+\GURFDUERQ3&(±3HUFKORURHWK\OHQH5$2±5HVSRQVH$FWLRQ2XWFRPH5&5$±5HVRXUFH&RQVHUYDWLRQDQG5HFRYHU\$FW5&5,6±5HVRXUFH&RQVHUYDWLRQDQG5HFRYHU\,QIRUPDWLRQ6\VWHP5(&±5HFRJQL]HG(QYLURQPHQWDO&RQGLWLRQ5:4&%±5HJLRQDO:DWHU4XDOLW\&RQWURO%RDUG6&$40'±6RXWK&RDVW$LU4XDOLW\0DQDJHPHQW'LVWULFW6'*±6LJQLILFDQW'DWD*DS6(06±6XSHUIXQG(QWHUSULVH0DQDJHPHQW6\VWHP653±6LWH5HPHGLDWLRQ3URJUDP64*±6PDOO4XDQWLW\*HQHUDWRU692&±6HPL9RODWLOH2UJDQLF&RPSRXQG7&(±7ULFKORURHWK\OHQH76')±7UHDWPHQW6WRUDJHDQGRU'LVSRVDO)DFLOLW\867±8QGHUJURXQG6WRUDJH7DQN9(&±9DSRU(QFURDFKPHQW&RQGLWLRQ92&±9RODWLOH2UJDQLF&RPSRXQG Hillmann Consulting LLC Phase I Environmental Site Assessment -1- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 1.0 FINDINGS, OPINIONS, AND CONCLUSIONS +LOOPDQQ&RQVXOWLQJ//&+LOOPDQQSHUIRUPHGD3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW(6$RI9DOOH\%RXOHYDUG)RQWDQD&DOLIRUQLDWKH6XEMHFW3URSHUW\7KHDVVHVVPHQWKDVEHHQFRQGXFWHGLQDFFRUGDQFHZLWKRXUFRQWUDFWHGVFRSHRIZRUNDQGWKH$6706WDQGDUG3UDFWLFH(IRU3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQWVDQG$OO$SSURSULDWH,QTXLULHV$$,)LQDO5XOH&)53DUW7KLVVHFWLRQFRQWDLQVDVXPPDU\RIILQGLQJVRSLQLRQVDQGFRQFOXVLRQVPDGH E\WKLVDVVHVVPHQW+RZHYHUWKLVVHFWLRQDORQHGRHVQRWFRQVWLWXWHWKHFRPSOHWHDVVHVVPHQW7KHUHSRUWPXVWEHUHDGLQLWVHQWLUHW\ 1.1 Summary of Project Details Primary Street Address: 9DOOH\%RXOHYDUG City: )RQWDQDCounty: 6DQ%HUQDGLQRState: &DOLIRUQLD Tax ID/Parcel Number: Property Owner: 5LYHUVLGH)RQWDQD Zoning Designation: &RPPHUFLDO Approx. Property Area: DFUHV Buildings: 2QHRIILFHWUDLOHU Approx. Building Size: Approx. Year Built: Commercial Occupants: 7UDQV:HVW7UXFN&HQWHUGED6RXWKHUQ&DOLIRUQLD*UHDW'DQH 7UDLOHUV Current Use: 7UDLOHUVDQGWUXFNVVWRUDJH Inspected By: 0V6KLOSD6XQLO Site Contact/Company: 0U-LP3LQHV Site Escort/Company: 0U0DU6DPD\RD6DOHV0DQDJHU Inspection Date: )HEUXDU\ Weather Conditions: 6XQQ\GHJUHHV) Hillmann Consulting LLC Phase I Environmental Site Assessment -2- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 1.2 Findings Summary Table Assessment Subject No REC REC CREC HREC SDG Rpt. Ref. Property Regulatory Records Review: ; Property Historical Records Review: ; Bulk Petroleum Storage: ; On-Site Operations: ; On-Site Haz-Mat Storage/Use/Spills: ; Transformers/Hydraulic Systems: ; Waste Discharges: ; Interviews: ; Adjoining & Nearby Properties: ; Prior Env. Reports/User Provided Info: ; 1.3 Findings, Opinions and Conclusions Recognized Environmental Conditions & Significant Data Gaps +LOOPDQQKDVSHUIRUPHGD3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQWLQDFFRUGDQFHZLWKWKHVFRSHDQGOLPLWDWLRQVRI$6703UDFWLFH(RIWKH6XEMHFW3URSHUW\DVGHVFULEHGLQ6HFWLRQRIWKLVUHSRUW$Q\DGGLWLRQVWRH[FHSWLRQVWRRUGHOHWLRQVIURPWKLVSUDFWLFHDUHDOVRGHVFULEHGLQ6HFWLRQRIWKLVUHSRUW7KLVDVVHVVPHQWKDVUHYHDOHGWKHIROORZLQJrecognized environmental conditions5(&Vcontrolledrecognized environmental conditions&5(&VDQGRUsignificant data gaps 6'*VLQFRQQHFWLRQZLWKWKH6XEMHFW3URSHUW\ RECOGNIZED ENVIRONMENTAL CONDITIONS 1R5(&VZHUHLGHQWLILHG CONTROLLED RECOGNIZED ENVIRONMENTAL CONDITIONS (CRECs) 1R&5(&VZHUHLGHQWLILHG SIGNIFICANT DATA GAPS (SDGs) 1R6'*VZHUHLGHQWLILHG Historical Recognized Environmental Conditions (HRECs) 7KLV DVVHVVPHQW KDV UHYHDOHGWKH IROORZLQJhistoricalrecognized environmental conditions +5(&VLQFRQQHFWLRQZLWKWKH6XEMHFW3URSHUW\ HISTORICAL RECOGNIZED ENVIRONMENTAL CONDITIONS 1R+5(&VZHUHLGHQWLILHG Hillmann Consulting LLC Phase I Environmental Site Assessment -3- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California De Minimis and Other Environmental Conditions 7KHIROORZLQJde minimisDQGRWKHUHQYLURQPHQWDOFRQGLWLRQVZHUHLGHQWLILHG OTHER ENVIRONMENTAL CONDITIONS / DE MINIMIS CONDITIONS +LOOPDQQREVHUYHGde minimisRLOVWDLQLQJVHHSKRWRRQWKHVRXWKHUQSRUWLRQRIWKH3URSHUW\KRZHYHUWKHVWDLQLQJGRHVQRWLQGLFDWHD5(&ZLWKFRQQHFWLRQWRWKH3URSHUW\ +LOOPDQQREVHUYHGDJDOORQSODVWLF$67FRQWDLQLQJZDWHUXWLOL]HGIRUZDVKLQJWUDLOHUVWKH\HDULQVWDOOHGLVXQNQRZQDQGQRVLJQVRIOHDNLQJDQGRUVWDLQLQJZHUHREVHUYHGKRZHYHUWKH$67GRHVQRWLQGLFDWHD5(&ZLWKFRQQHFWLRQWRWKH3URSHUW\ 7UXFN7RZQDW&KHUU\$YHQXHLVOLVWHGRQWKH/867GDWDEDVH7KHVLWHLVDGMDFHQWWRWKHVRXWKHDVWDQGLV GRZQFURVVJUDGLHQWUHODWLYHWRWKH3URSHUW\7KH/867OLVWLQJLQGLFDWHGVRLOZDVFRQWDPLQDWHGDWWKHVLWHZLWKWRWDOSHWUROHXPK\GURFDUERQVIURPDOHDNLQJ867ZLWKDOHDNILUVWEHLQJGHWHFWHGLQ6HSWHPEHU7KHVLWHZDVJUDQWHGUHJXODWRU\FORVXUHZLWKD1R)XUWKHU$FWLRQ/HWWHUDVRI0D\0XOWLSOHHQYLURQPHQWDOVLWHDVVHVVPHQWVKDGEHHQFRQGXFWHGRQVLWHVLQFHWKHODWHVVRLODQGVRLOJDVVDPSOHVLQGLFDWHGLQFUHDVLQJOHYHOVRI73+GLHVHOGXULQJ WKHHDUO\V7KHVLWHZDVSODFHGRQD&RUUHFWLYH$FWLRQ3ODQLQDQGVRLOYDSRUVDPSOLQJZDVFRQGXFWHGLQ-XO\/DERUDWRU\DQDO\VLVLQGLFDWHG73+JEHQ]HQHDQG07%(FRQFHQWUDWLRQVRIDQGSSP,Q $XJXVWIRXUVHWVRIGXDOFRPSOHWLRQVRLOYDSRUH[WUDFWLRQZHOOVZHUHLQVWDOOHGRQVLWHDQGYRODWLOHRUJDQLFFRPSRXQGV92&VZHUHQRWGHWHFWHGLQVRLOJDVVDPSOHVFROOHFWHGLQWKHDUHDRIWKHIRUPHU867KRZHYHU07%(ZDVGHWHFWHGDWDFRQFHQWUDWLRQRIXSWRSSPY$GGLWLRQDOO\LQ0DUFKDGD\69(HYHQWZDVFRQGXFWHGWRGHPRQVWUDWHDIXUWKHUUHGXFWLRQRIVRLOJDVSDUWLFXODUO\07%($WRWDORIOEVKDYHEHHQUHFRYHUHGGXULQJ WKH69(DFWLYLWLHVEHWZHHQDQGKRZHYHUWKH1)$OHWWHUFRQFOXGHGWKHIROORZLQJ³no the vertical extent of the TPH-diesel affected soil was not defined due to the cost to define the contamination beyond the detected 180 feet bgs and the depth of groundwater being greater than 300 feet bgs.” +RZHYHUEDVHGRQWKHGRZQJUDGLHQWSRVLWLRQDQGUHJXODWRU\FORVXUHWKLVOLVWLQJGRHVQRWLQGLFDWHD5(&ZLWKFRQQHFWLRQWRWKH3URSHUW\ +LOOPDQQ REVHUYHG PXOWLSOHJDOORQ FRQWDLQHUV FRQWDLQLQJ JDVROLQH DQG PXOWLSOH GHJUHDVHUV0U0DU6DPD\RDLQGLFDWHGWKHGHJUHDVHULVXWLOL]HGIRUPLQRUWUDLOHUUHSDLUVRQWKH3URSHUW\KRZHYHUWKHJDVROLQHDQGGHJUHDVHUVGRQRWLQGLFDWHD5(&ZLWKFRQQHFWLRQWRWKH3URSHUW\7KH3URSHUW\ZDVKLVWRULFDOO\XWLOL]HGIRUDJULFXOWXUDOSXUSRVHV*LYHQWKHVXEVHTXHQWVLWHUHGHYHORSPHQWWKHSRWHQWLDOIRUFRQFHQWUDWHGSHVWLFLGHVLQVKDOORZVRLOVLVFRQVLGHUHGWREHORZDQGWKHUHIRUHKLVWRULFDODJULFXOWXUDOXVHLVQRW FRQVLGHUHGD5(& 7KH3URSHUW\ZDVGHYHORSHGLQWRLWVFXUUHQWFRQILJXUDWLRQDVDWUDQVSRUWDWLRQWUXFNDQGRUWUDLOHUVDOHV\DUGVLQFHDSSUR[LPDWHO\WKHVWRSUHVHQW7KHIXWXUHLQWHQGHGXVDJHRIWKH3URSHUW\ZLOOEHDFRPPHUFLDOZDUHKRXVHEXLOGLQJ7KHDGMRLQLQJSURSHUWLHVDSSHDUWRKDYHEHHQGHYHORSHGDVDFDUWUXFNDQGWUDLOHUVDOHVFHQWHUVVLQFHDSSUR[LPDWHO\WKHODWHVWRSUHVHQW 7UDQV:HVW7UXFN&HQWHUDW9DOOH\%RXOHYDUGLVOLVWHGRQWKH),1'613'(6DQG&,:46GDWDEDVHV7KH),1'6OLVWLQJLQGLFDWHGD5HJLVWU\,'RI7KH13'(6OLVWLQJLQGLFDWHGD³&RQVWUXFWLRQ´GDWDEDVHZLWKD³WHUPLQDWHG´VWDWXV7KH&,:46OLVWLQJLQGLFDWHGD³&RQVWUXFWLRQ±FRPPHUFLDO´VWRUPZDWHUFRQVWUXFWLRQZLWKDWHUPLQDWLRQGDWHRI. *UHDW'DQH7UDLOHUVDW9DOOH\%RXOHYDUGLV5&5$1RQ*HQ1/5+:76+$8/(56GDWDEDVHV7KH5&5$1RQ*HQ1/5OLVWLQJLQGLFDWHGWKH3URSHUW\LVQRWOLVWHGRQDKD]DUGRXVZDVWHJHQHUDWRUZLWKQRYLRODWLRQVQRWHG7KH+:76OLVWLQJLQGLFDWHGD³7UXFN7UDLOHU0DQXIDFWXULQJ´ZLWKDQ³,QDFWLYH´GDWHDVRI7KH+$8/(56OLVWLQJLQGLFDWHGWKH3URSHUW\QDPHDGGUHVVIDFLOLW\,'RIDQGDQ³$FWLYH´VWDWXV 5XVK7UXFN&HQWHUV±8VHG7UXFN6DOHVDW9DOOH\%RXOHYDUGLVOLVWHGRQWKH+:76&(56+$=:$67(+$=1(76$1%(51&3(50,7&(56DQG5&5$1RQ*HQ1/5GDWDEDVH7KHVLWHLVDGMDFHQWWRWKHZHVWDQG LVGRZQFURVVJUDGLHQWUHODWLYHWRWKH3URSHUW\7KH+$=1(7OLVWLQJLQGLFDWHGPXOWLSOHWRQVRI³RWKHURUJDQLFVROLGV´DQG³XQVSHFLILHGDTXHRXVVROXWLRQV´ZHUHVWRUHGEXONHGDQGRUWUDQVIHUUHGRIIVLWHLQDQG7KH+:76 OLVWLQJLQGLFDWHGWKHVLWHLVOLVWHGRQWKH³+D]DUGRXV:DVWH*HQHUDWRU´GDWDEDVHZLWKD&(56,'RI7KH6$1%(51&23(50,7OLVWLQJLQGLFDWHGD³VPDOOTXDQWLW\JHQHUDWRU´ZLWKDQH[SLUDWLRQGDWHDVRI7KH&(56OLVWLQJLQGLFDWHGPXOWLSOHDGPLQLVWUDWLYHYLRODWLRQV2QHYLRODWLRQLQGLFDWHGIDLOXUHWRHVWDEOLVKD&RQWLQJHQF\3ODQIDLOXUHRIDJHQHUDWRURIKD]DUGRXVZDVWHWKDWPHHWVWKHFRQGLWLRQVWREHWUDQVSRUWHGRQDFRQVROLGDWHGPDQLIHVW WRFRPSO\ZLWKRQHRUPRUHRIWKHUHTXLUHGFRQVROLGDWHGPDQLIHVWLQJSURFHGXUHVDQGUHWDLQFRSLHVRIUHFHLSWVIRUWKUHH\HDUVDQGIDLOXUHWRFRPSOHWHDQGHOHFWURQLFDOO\VXEPLWKD]DUGRXVPDWHULDOLQYHQWRU\LQIRUPDWLRQIRUDOOUHSRUWDEOH KD]DUGRXVPDWHULDOVRQVLWHDWRUDERYHUHSRUWDEOHTXDQWLWLHV+RZHYHUPRVWRIWKHYLRODWLRQVDSSHDUWREHUHODWLYHO\ Hillmann Consulting LLC Phase I Environmental Site Assessment -4- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California PLQRULQVFDOHDQGGRQRWLQGLFDWHD5(&ZLWKFRQQHFWLRQWRWKH3URSHUW\7KH5&5$1RQ*HQ1/5OLVWLQJLQGLFDWHGWKHVLWHLVQRWRQDKD]DUGRXVZDVWHJHQHUDWRUGDWDEDVHZLWKQRYLRODWLRQVQRWHG Environmental Professional Statement ,:HGHFODUHWKDWWRWKHEHVWRIP\SURIHVVLRQDONQRZOHGJHDQGEHOLHI,ZHPHHWWKHGHILQLWLRQRI Environmental professional DV GHILQHG LQ RI &)5 ,ZHKDYH WKH VSHFLILFTXDOLILFDWLRQVEDVHGRQHGXFDWLRQWUDLQLQJDQGH[SHULHQFHWRDVVHVVDproperty RIWKHQDWXUHKLVWRU\DQGVHWWLQJRIWKHsubjectproperty,:HKDYHGHYHORSHGDQGSHUIRUPHGDOODSSURSULDWHLQTXLULHVLQFRQIRUPDQFHZLWKWKHVWDQGDUGVDQGSUDFWLFHVVHWIRUWKLQ&)53DUW BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB5\DQ7HUZLOOLJHU(QYLURQPHQWDO3URIHVVLRQDO Hillmann Consulting LLC Phase I Environmental Site Assessment -5- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 1.4 Business Environmental Risks / Non-ASTM Scope +LOOPDQQKDVSHUIRUPHGDOLPLWHGUHYLHZRIWKHIROORZLQJSRWHQWLDO%XVLQHVV(QYLURQPHQWDO5LVNV%(5DOVRNQRZQDV³1RQ$6706FRSHFRQFHUQV´LQDFFRUGDQFHZLWKWKHFRQWUDFWHGVFRSHRIZRUNVFRSHIRUWKLVDVVHVVPHQW%(5LVGHILQHGE\$670(DV“a risk which can have a material environmental or environmentally-driven impact on the business associated with the current or planned use of a parcel of commercial real estate, not necessarily limited to those environmental issues required to be investigated in this practice.”7KHIROORZLQJLVDVXPPDU\RIILQGLQJVIRUWKHOLPLWHGUHYLHZRISRWHQWLDO%(5VZKHUHDSSOLFDEOHDVSHUWKHFRQWUDFWHGVFRSHRIZRUNDQGOLPLWDWLRQVRXWOLQHGLQ6HFWLRQ)RUDPRUHGHWDLOHGGLVFXVVLRQRIWKHILQGLQJVDQGFRQWUDFWHGVFRSHRIZRUNSOHDVHVHHWKHUHIHUHQFHGUHSRUWVHFWLRQ BUSINESS ENVIRONMENTAL RISKS / NON-ASTM SCOPE Subject Findings Not Appl. Rpt. Ref. Asbestos ; Lead Paint ; Radon 3URSHUW\LVORFDWHGLQWKH86(3$UDGRQGHVLJQDWLRQ=RQHRU PRGHUDWHULVN DUHDIRUUDGRQ Mold / Microbial Damage ; NWI Wetlands 7KHUHYLHZGLGQRWLQGLFDWHUHJXODWHGZHWODQGDUHDVRQWKH3URSHUW\ Lead in Drinking Water 3RWDEOHZDWHUVHUYLFHDWWKH3URSHUW\LVSURYLGHGE\DXWLOLW\FRQQHFWLRQZLWKWKH)RQWDQD:DWHU&RPSDQ\$UHFHQWO\SXEOLVKHGZDWHUTXDOLW\UHSRUWIURPWKHXWLOLW\LQGLFDWHGFRPSOLDQFHZLWK86(3$ZDWHUTXDOLW\VWDQGDUGVIRUOHDGLQGULQNLQJZDWHU$FRS\RIWKHUHSRUWKDVEHHQDWWDFKHGLQ$SSHQGL[) Hillmann Consulting LLC Phase I Environmental Site Assessment -6- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 2.0 INTRODUCTION 2.1 Purpose and Scope 7KLVDVVHVVPHQWZDVFRQGXFWHGXWLOL]LQJJHQHUDOO\DFFHSWHG3KDVH,(6$LQGXVWU\VWDQGDUGVLQDFFRUGDQFHZLWKWKH$6706WDQGDUG3UDFWLFH(7KH$670GHVFULEHVWKHVHPHWKRGRORJLHVDVUHSUHVHQWLQJJRRGFRPPHUFLDODQGFXVWRPDU\SUDFWLFHLQWKH8QLWHG6WDWHVRI$PHULFDIRUFRQGXFWLQJDQHQYLURQPHQWDOVLWHDVVHVVPHQWRIDSDUFHORIFRPPHUFLDOUHDOHVWDWHZLWKUHVSHFWWR WKH UDQJH RI FRQWDPLQDQWVZLWKLQ WKH VFRSH RI WKH &RPSUHKHQVLYH (QYLURQPHQWDO 5HVSRQVH &RPSHQVDWLRQDQG/LDELOLW\$FW&(5&/$86&DQGSHWUROHXPSURGXFWV$VVXFKWKLVSUDFWLFHLVLQWHQGHGWRSHUPLWDXVHUWRVDWLVI\RQHRIWKHUHTXLUHPHQWVWRTXDOLI\IRUWKHLQQRFHQWODQGRZQHUFRQWLJXRXVSURSHUW\RZQHURUERQDILGHSURVSHFWLYHSXUFKDVHUOLPLWDWLRQVRQ&(5&/$OLDELOLW\KHUHLQDIWHUWKH³ODQGRZQHUOLDELOLW\SURWHFWLRQV´RU³//3V´WKDWLVWKHSUDFWLFHWKDW FRQVWLWXWHVDOODSSURSULDWHLQTXLULHVLQWRWKHSUHYLRXVRZQHUVKLSDQGXVHVWKHSURSHUW\FRQVLVWHQW ZLWKJRRGFRPPHUFLDODQGFXVWRPDU\SUDFWLFHDVGHILQHGDW86&%7KHJRDORIWKHSURFHVVHVHVWDEOLVKHGE\$670(LVWRLGHQWLI\recognized environmental conditionsLQFRQQHFWLRQZLWKWKH6XEMHFW3URSHUW\ 7KHWHUPrecognized environmental condition5(&LVGHILQHGE\$670(DV“(1) the presence of hazardous substances or petroleum products in, on, or at the subject property due to a release to the environment; (2) the likely presence of hazardous substances or petroleum products in, on, or at the subject property due to a release or likely release to the environment; or (3) the presence of hazardous substances or petroleum products in, on, or at the subject property under conditions that pose a material threat of a future release to the environment.” 7KHWHUPcontrolled recognized environmental conditionLVDW\SHRIUHFRJQL]HGHQYLURQPHQWDOFRQGLWLRQDQGGHILQHGE\$670(DVD“recognized environmental condition affecting the subject property that has been addressed to the satisfaction of the applicable regulatory authority or authorities with hazardous substances or petroleum products allowed to remain in place subject to implementation of required controls (for example, activity and use limitations or other property use limitations).”7KH WHUPhistorical recognized environmental condition LV GHILQHG DVD“previous release of hazardous substances or petroleum products affecting the subject property that has been addressed to the satisfaction of the applicable regulatory authority or authorities and meeting unrestricted use criteria established by the applicable regulatory authority or authorities without subjecting the subject property to any controls (for example, activity and use limitations or other property use limitations).”7KH $670 ( VWDQGDUG KDV FODULILHG WKDW Dhistorical recognized environmental condition+5(&LVQRWDrecognized environmental condition 5(&7KHWHUPde minimis conditionLVGHILQHGE\WKH$670“…a condition related to a release that generally does not present a threat to human health or the environment and that generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.”$FRQGLWLRQGHWHUPLQHGWREHDde minimis conditionLVQRW5(&QRUD&5(&7KHFKLHIFRPSRQHQWVRIWKLVDVVHVVPHQWDUHJHQHUDOO\GHVFULEHGDVIROORZV Hillmann Consulting LLC Phase I Environmental Site Assessment -7- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California • $ QRQLQYDVLYH YLVXDO UHFRQQDLVVDQFH RIWKH 6XEMHFW 3URSHUW\DQG DGMRLQLQJ SURSHUWLHV LQDFFRUGDQFHZLWK$670JXLGHOLQHVIRUHYLGHQFHRI5(&V • ,QWHUYLHZVRISDVWDQGSUHVHQWRZQHUVDQGRFFXSDQWVDQGVWDWHDQGORFDOJRYHUQPHQWRIILFLDOV VHHNLQJLQIRUPDWLRQUHODWHGWRWKHSRWHQWLDOSUHVHQFHRI5(&VDWWKH6XEMHFW3URSHUW\ • $ UHYLHZ RI VWDQGDUG SK\VLFDO UHFRUG VRXUFHV IRU DYDLODEOH WRSRJUDSKLF JHRORJLF DQGJURXQGZDWHUGDWD • $UHYLHZRIVWDQGDUGKLVWRULFUHFRUGVRXUFHVVXFKDVILUHLQVXUDQFHPDSVFLW\GLUHFWRULHVDHULDOSKRWRJUDSKVSULRUUHSRUWVDQGLQWHUYLHZVHWFWRGHWHUPLQHSULRUXVHVRIWKH6XEMHFW3URSHUW\IURPWKHSUHVHQWEDFNWRWKH6XEMHFW3URSHUW\¶VILUVWGHYHORSHGXVHRUEDFNWRZKLFKHYHU LVHDUOLHU • $UHYLHZRIVWDQGDUGHQYLURQPHQWDOUHFRUGVRXUFHVLQFOXGLQJIHGHUDODQGVWDWHHQYLURQPHQWDOGDWDEDVHV DQG DGGLWLRQDO HQYLURQPHQWDO UHFRUG VRXUFHV WR LGHQWLI\ SRWHQWLDO UHJXODWRU\ FRQFHUQVZLWKWKH6XEMHFW3URSHUW\DGMRLQLQJSURSHUWLHVDQGSURSHUWLHVORFDWHGZLWKLQWKH VXUURXQGLQJDUHD$QHYDOXDWLRQRIHQYLURQPHQWDORURWKHUUHJXODWRU\FRPSOLDQFHPDWWHUVLVH[FOXGHGIURPWKHVFRSHRIWKLVDVVHVVPHQW 7KHVHPHWKRGRORJLHVDUHGHVFULEHGDVUHSUHVHQWLQJJRRGFRPPHUFLDODQGFXVWRPDU\SUDFWLFHIRUFRQGXFWLQJ DQ (QYLURQPHQWDO 6LWH $VVHVVPHQW RI D SURSHUW\ IRU WKH SXUSRVH RI LGHQWLI\LQJUHFRJQL]HGHQYLURQPHQWDOFRQGLWLRQV Business Environmental Risks/Non-ASTM Scope Considerations ,QDFFRUGDQFHZLWKRXUFRQWUDFWDJUHHPHQW+LOOPDQQPD\KDYHDGGUHVVHGWKHIROORZLQJSRWHQWLDOHQYLURQPHQWDOVXEMHFWPDWWHUVWKDWDUHRXWVLGHRIWKHUHTXLUHPHQWVRIWKH$670(VWDQGDUG • $VEHVWRV&RQWDLQLQJ 0DWHULDOV $&0$ FXUVRU\QRQLQWUXVLYHYLVXDOVFUHHQLQJIRU WKHSUHVHQFHRIVXVSHFW$&0ZLWKLQWKHDFFHVVHGDUHDVRIEXLOGLQJVEXLOWSULRUWRRQWKH6XEMHFW3URSHUW\,IWKH6XEMHFW3URSHUW\FRQWDLQVEXLOGLQJVEXLOWLQRUODWHUWKHFRQWUDFWHGVFRSHRIZRUNH[FOXGHVDFXUVRU\QRQLQWUXVLYHYLVXDOVFUHHQLQJRUDQ\RWKHUOHYHORIHYDOXDWLRQIRUVXVSHFW$&0KRZHYHUWKHH[FOXVLRQIRUEXLOGLQJVEXLOWVKRXOGQRWEHLQWHUSUHWHGWR VXJJHVWWKDWDQ\VXFKEXLOGLQJVDUHIUHHRI$&0RUZRXOGQRWZDUUDQWHYDOXDWLRQRIEXLOGLQJPDWHULDOVIRU$&0SULRUWRGLVWXUEDQFH,WLVHPSKDVL]HGWKDWWKLVFXUVRU\QRQLQWUXVLYHYLVXDOVFUHHQLQJ GRHV QRW FRQVWLWXWH DQDVEHVWRV VXUYH\LQVSHFWLRQRI WKH SUHPLVHV $Q DVEHVWRVVXUYH\LQVSHFWLRQ VKRXOG EH VRXJKW E\ WKH UHSRUW 8VHUV LID JUHDWHUFHUWDLQW\ LV GHVLUHGUHJDUGLQJ$&0DQGSRWHQWLDODVEHVWRVKD]DUGVDWWKH6XEMHFW3URSHUW\)XUWKHUPRUHDUHYLHZ RIUHJXODWRU\FRPSOLDQFHPDWWHUVSHUWDLQLQJWRDVEHVWRVLVH[FOXGHGIURPWKHVFRSHRIZRUN • /HDG%DVHG3DLQW/%3$FXUVRU\QRQLQWUXVLYHYLVXDOVFUHHQLQJRIWKHFRQGLWLRQRISDLQWHGVXUIDFHVLQWKHDFFHVVHGDUHDVRIUHVLGHQWLDOEXLOGLQJVXQLWVEXLOWSULRUWRRQWKH6XEMHFW 3URSHUW\,IWKH3URSHUW\FRQWDLQVEXLOGLQJVEXLOWLQRUODWHUWKHFRQWUDFWHGVFRSHRIZRUN H[FOXGHVDQ\FXUVRU\QRQLQWUXVLYHYLVXDOVFUHHQLQJRURWKHUOHYHORIHYDOXDWLRQIRUVXVSHFW Hillmann Consulting LLC Phase I Environmental Site Assessment -8- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California /3%KRZHYHUWKHVFRSHRIZRUNH[FOXVLRQIRUEXLOGLQJEXLOWVKRXOGQRWEHLQWHUSUHWHGWRVXJJHVWWKDWDQ\VXFKEXLOGLQJVDUHIUHHRI/3%RURWKHUOHDGKD]DUGV,WLVHPSKDVL]HGWKDWWKLVFXUVRU\QRQLQWUXVLYHYLVXDOVFUHHQLQJGRHVQRWFRQVWLWXWHDFRPSUHKHQVLYHVXUYH\IRU/%3RUSRWHQWLDOOHDGKD]DUGV$FRPSUHKHQVLYHLQVSHFWLRQVKRXOGEHVRXJKWE\WKHUHSRUW8VHUVLIPRUHFHUWDLQW\LVGHVLUHGUHJDUGLQJ/%3DWWKH6XEMHFW3URSHUW\)XUWKHUPRUHDUHYLHZRI UHJXODWRU\FRPSOLDQFHPDWWHUVSHUWDLQLQJWROHDGEDVHGSDLQWLVH[FOXGHGIURPWKHVFRSHRIZRUN • 86(3$'HVLJQDWHG5DGRQ3RWHQWLDO5HYLHZRIJHQHUDOQRQVLWHVSHFLILFGDWDSXEOLVKHGE\WKH 86(3$UHJDUGLQJWKH5DGRQ=RQHFODVVLILFDWLRQIRUWKHDUHDRIWKH6XEMHFW3URSHUW\ • 0ROG0LFURELDO'DPDJH$FXUVRU\QRQLQWUXVLYHYLVXDOVFUHHQLQJZLWKLQWKHDFFHVVHGDUHDVRIEXLOGLQJVRQWKH6XEMHFW3URSHUW\IRUHYLGHQFHRIV\VWHPLFPLFURELDOSUREOHPVLQFOXGLQJYLVLEOHPROGJURZWKZDWHUGDPDJHGEXLOGLQJPDWHULDOVRUPXVW\RGRUV,WLVHPSKDVL]HGWKDW WKLVFXUVRU\QRQLQWUXVLYHYLVXDOVFUHHQLQJGRHVQRWFRQVWLWXWHDFRPSUHKHQVLYHVXUYH\IRUPRLVWXUHPROGPLFURELDOGDPDJH$PRUHFRPSUHKHQVLYHLQVSHFWLRQVKRXOGEHVRXJKWE\WKHUHSRUW8VHUVLIPRUHFHUWDLQW\LVGHVLUHGUHJDUGLQJWKHSRWHQWLDOIRUPRLVWXUHPROGPLFURELDOGDPDJHVDWWKH6XEMHFW3URSHUW\ • 1:,:HWODQGV7KH3URSHUW\KDVEHHQUHYLHZHGIRUMXULVGLFWLRQDOZHWODQGVXVLQJWKH1DWLRQDO:HWODQGV,QYHQWRU\:HWODQG0DSSHUKWWSZHWODQGVIZVHUXVJVJRY1:,GRZQORDGKWPOWRGHWHUPLQHZKHWKHUPDSSHGIHGHUDOZHWODQGVKDYHEHHQLQGLFDWHGRQWKH6XEMHFW3URSHUW\$Q\IXUWKHUHYDOXDWLRQRUOHJDOGHOLQHDWLRQRIUHJXODWHGZHWODQGVDUHDVLVH[FOXGHGIURPWKHVFRSH RIZRUN,WLVDOVRHPSKDVL]HGWKDWDILHOGGHOLQHDWLRQRIUHJXODWHGZHWODQGVE\DTXDOLILHG SURIHVVLRQDOZRXOGEHZDUUDQWHGWRPRUHIXOO\GHWHUPLQHWKHSUHVHQFHRUDEVHQFHRIUHJXODWHGZHWODQGVDWWKH6XEMHFW3URSHUW\ • /HDGLQ'ULQNLQJ:DWHU5HYLHZRIWKHSRWHQWLDOIRUHOHYDWHGOHYHOVRIOHDGLQWKHGULQNLQJZDWHU E\GHWHUPLQLQJWKHVRXUFHRIWKHGULQNLQJZDWHUVXSSO\DQGDUHYLHZRIDYDLODEOHWHVWLQJRUFRPSOLDQFHGDWDUHSRUWV 2.2 Property Location/Legal Description 3URSHUW\ORFDWLRQDQGOHJDOGHVFULSWLRQGHWDLOVDUHGHVFULEHGDVIROORZV Primary Street Address: 9DOOH\%RXOHYDUG City: )RQWDQDCounty: 6DQ%HUQDGLQRState: &DOLIRUQLD Tax ID/Parcel Number: Approx. Land Area: DFUHV Apprx. Latitude/Longitude: 1RUWKGHJUHHV:HVWGHJUHHV Additional Details (if appl.): 1$ Property Owner: 5LYHUVLGH)RQWDQD Zoning Designation: &RPPHUFLDO Hillmann Consulting LLC Phase I Environmental Site Assessment -9- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 2.3 Data Gaps $data gapLVGHILQHGE\WKH$670DVDODFNRIRULQDELOLW\WRREWDLQLQIRUPDWLRQUHTXLUHGE\WKLVSUDFWLFHGHVSLWHJRRGIDLWKHIIRUWVE\WKHHQYLURQPHQWDOSURIHVVLRQDOWRJDWKHUVXFKLQIRUPDWLRQ$GDWDJDSLVRQO\VLJQLILFDQWLIRWKHULQIRUPDWLRQDQGRUSURIHVVLRQDOH[SHULHQFHUDLVHVUHDVRQDEOHFRQFHUQVLQYROYLQJWKHGDWDJDSDQGWKHDELOLW\WRGHWHUPLQHWKHSUHVHQFHRUDEVHQFHRIUHFRJQL]HG HQYLURQPHQWDO FRQGLWLRQV7KH IROORZLQJ WDEOH VXPPDUL]HV GDWD JDSV HQFRXQWHUHG GXULQJ WKHDVVHVVPHQWDVZHOODVDGLVFXVVLRQRIWKHLUVLJQLILFDQFH Data Gap: Significant (Yes/No)? Discussion +LVWRULFDOUHFRUGVGDWDIDLOXUH1R7KH GDWHDQGRU W\SHRIWKHILUVW GHYHORSHG XVHRIWKH 6XEMHFW3URSHUW\ZDVQRWGRFXPHQWHG5HFRUGJDSVH[FHHGLQJILYH\HDUVZHUHHQFRXQWHUHGKRZHYHUQRVLJQLILFDQWVLWHXVHFKDQJHVDUHVXVSHFWHGGXULQJWKHVHLQWHUYDOV 5HVSRQVHWRDJHQF\UHFRUGVUHTXHVWVQRWUHFHLYHGDVRIGDWH RIUHSRUW 1R$Q\DGGLWLRQDOLQIRUPDWLRQLQGLFDWLYHRID5(&ZLOOEHIRUZDUGHGXSRQUHFHLSW 2.4 ESA Report Component Dates/Viability 7KH$670(VWDQGDUGVWDWHVWKDWDQHQYLURQPHQWDOVLWHDVVHVVPHQW(6$LVSUHVXPHGWR EHYLDEOHZKHQLWLVFRQGXFWHGZLWKLQGD\VSULRUWRWKHGDWHRIDFTXLVLWLRQRIWKH6XEMHFW3URSHUW\RUIRUWUDQVDFWLRQVQRWLQYROYLQJDQDFTXLVLWLRQVXFKDVDOHDVHRUUHILQDQFHWKHGDWHRIWKHLQWHQGHGWUDQVDFWLRQ6SHFLILFDOO\DOORIWKHIROORZLQJFRPSRQHQWVPXVWEHFRQGXFWHGRUXSGDWHGZLWKLQGD\VSULRUWRWKHGDWHRIDFTXLVLWLRQRUSULRUWRWKHGDWHRIWKHWUDQVDFWLRQ7KH IROORZLQJWDEOHVXPPDUL]HVWKHFRPSRQHQWFRPSOHWLRQGDWHV ESA Component Completion Date ,QWHUYLHZV)HEUXDU\ (QY/LHQ6HDUFKH[FOXGHGIURPVFRSH *RYHUQPHQW5HFRUGV5HYLHZ)HEUXDU\ 9LVXDO,QVSHFWLRQV)HEUXDU\ (QY3URIHVVLRQDO'HFODUDWLRQ0DUFK 2.5 User Reliance 7KLVUHSRUWLVIRUWKHH[FOXVLYHXVHRI(3'6ROXWLRQVDQGDGGLWLRQDOUHO\LQJHQWLWLHVLIDQ\QDPHGRQWKHIURQWFRYHU1RDGGLWLRQDOLQGLYLGXDOVRUHQWLWLHVVKDOOEHSHUPLWWHGWRUHO\XSRQDQ\GDWDLQWHUSUHWDWLRQUHSRUWVRURWKHULQIRUPDWLRQRUGRFXPHQWDWLRQFRQWDLQHGLQWKLVUHSRUWZLWKRXWILUVW REWDLQLQJWKHFRQVHQWRI(3'6ROXWLRQVDQGZLWKRXWREWDLQLQJZULWWHQFRQVHQWIURP+LOOPDQQLQ WKHIRUPRIDUHOLDQFHDJUHHPHQWOHWWHU+LOOPDQQPD\LQLWVVROHGLVFUHWLRQZLWKKROGLWVFRQVHQWWRDGGLWLRQDOUHOLDQFHDQGRU+LOOPDQQPD\FRQGLWLRQFRQVHQWIRUUHOLDQFHXSRQSD\PHQWRIDIHHRURWKHUFRQGLWLRQV Hillmann Consulting LLC Phase I Environmental Site Assessment -10- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 2.6 Significant Assumptions 7KHIROORZLQJVLJQLILFDQWDVVXPSWLRQVDUHPDGH • 7KHVLWHRSHUDWLRQVDWWKHWLPHRIWKHVLWHYLVLWDUHDVVXPHGWRUHIOHFWW\SLFDOVLWHFRQGLWLRQV UHODWLYH WR SRWHQWLDO HQYLURQPHQWDO FRQGLWLRQV DQG WKDW QR FRQFHDOPHQW RI HQYLURQPHQWDOFRQGLWLRQVRUUHOHDVHVE\VLWHRZQHUVRURFFXSDQWVKDVRFFXUUHG/LNHZLVHLWLVDVVXPHGWKDWQRDUHDVRIWKH6XEMHFW3URSHUW\ZLWKSRWHQWLDOHQYLURQPHQWDOFRQFHUQVRU5(&VZHUHFRQFHDOHGRU RWKHUZLVH QRWUHSRUWHG LQWHQWLRQDOO\ RU XQNQRZLQJO\ E\WKH 6XEMHFW 3URSHUW\RZQHUVRFFXSDQWVDQGRUVLWHHVFRUWDWWKHWLPHRIWKHVLWHYLVLW • )RUWKHSXUSRVHRIHVWLPDWLQJWKHDSSUR[LPDWHGLUHFWLRQRIJURXQGZDWHUIORZLQWKHDEVHQFHRIVLWHVSHFLILFJURXQGZDWHUGDWDXQOHVVLQGLFDWHGRWKHUZLVHDQDVVXPSWLRQKDVEHHQPDGHWKDWWKHJUDGLHQWRIJURXQGZDWHUIORZIROORZVWKHVXUIDFHWRSRJUDSK\RIWKH6XEMHFW3URSHUW\DQG LPPHGLDWHVXUURXQGLQJDUHD 2.7 General Limitations and Exceptions Limitations 7KHUHSRUWWXUQDURXQGWLPHVSHFLILHGE\WKHFRQWUDFWDJUHHPHQWIRUWKLVDVVHVVPHQWPD\SUHVHQWD OLPLWDWLRQ WRWKH DYDLODELOLW\ RISHUWLQHQW UHJXODWRU\ DJHQF\UHFRUGV 6XFK OLPLWDWLRQV LIHQFRXQWHUHGZRXOGEHIXUWKHUVSHFLILHGLQ6HFWLRQ6LJQLILFDQWOLPLWDWLRQVUHODWHGWRWKHFRQGLWLRQRUDFFHVVLELOLW\RIWKH6XEMHFW3URSHUW\DWWKHWLPHRIWKHVLWHUHFRQQDLVVDQFHLIHQFRXQWHUHGDUHUHSRUWHGLQ6HFWLRQ Other Exceptions or Deletions 1RRWKHUH[FHSWLRQVRUGHOHWLRQVIURPWKH$6706WDQGDUG(DUHUHSRUWHG Special Terms and Conditions 7KLV3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQWKDVEHHQSUHSDUHGXVLQJUHDVRQDEOHHIIRUWVLQHDFKSKDVH RI LWV ZRUN WR LGHQWLI\ UHFRJQL]HG HQYLURQPHQWDO FRQGLWLRQV DVVRFLDWHG ZLWK KD]DUGRXVVXEVWDQFHVZDVWHVDQGSHWUROHXPSURGXFWVDWWKH6XEMHFW3URSHUW\)LQGLQJVZLWKLQWKLVUHSRUWDUH EDVHGRQLQIRUPDWLRQFROOHFWHGIURPREVHUYDWLRQVPDGHRQWKHGD\RIWKHVLWHUHFRQQDLVVDQFHDQGIURPUHDVRQDEO\DVFHUWDLQDEOHLQIRUPDWLRQREWDLQHGIURPJRYHUQLQJSXEOLFDJHQFLHVDQGSULYDWHVRXUFHV7KLVUHSRUWLVQRWGHILQLWLYHDQGVKRXOGQRWEHDVVXPHGWREHDFRPSOHWHRUVSHFLILFGHILQLWLRQRI WKHFRQGLWLRQVDERYHRUEHORZJUDGH,QIRUPDWLRQLQWKLVUHSRUWLVQRWLQWHQGHGWREHXVHGDVDFRQVWUXFWLRQ GRFXPHQWDQG VKRXOG QRW EH XVHG IRU GHPROLWLRQ UHQRYDWLRQ VLWH GHYHORSPHQWUHGHYHORSPHQWRURWKHUFRQVWUXFWLRQSXUSRVHV1RUHSUHVHQWDWLRQRUZDUUDQW\LVPDGHWKDWWKHSDVWRUFXUUHQWRSHUDWLRQVDWWKH6XEMHFW3URSHUW\DUHRUKDYHEHHQLQFRPSOLDQFHZLWKDOODSSOLFDEOHIHGHUDOVWDWHDQGORFDOODZVUHJXODWLRQVDQGFRGHV Hillmann Consulting LLC Phase I Environmental Site Assessment -11- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California )LQGLQJV FRQFOXVLRQV DQG UHFRPPHQGDWLRQVSUHVHQWHG LQ WKLV UHSRUW DUH EDVHG RQ YLVXDOREVHUYDWLRQVRIWKH6XEMHFW3URSHUW\LQWHUYLHZVFRQGXFWHGWKHUHFRUGVUHYLHZHGLQIRUPDWLRQSURYLGHGE\WKH&OLHQWDQGRUDUHYLHZRIUHDGLO\DYDLODEOHDQGVXSSOLHGGUDZLQJVDQGGRFXPHQWV,QIRUPDWLRQREWDLQHGGXULQJWKHDVVHVVPHQWZKHWKHUZULWWHQJUDSKLFRUYHUEDOSURYLGHGE\WKH 6XEMHFW3URSHUW\FRQWDFWVRUDVVKRZQRQDQ\GRFXPHQWVUHYLHZHGRUUHFHLYHGIURPWKH6XEMHFW3URSHUW\FRQWDFWRZQHURUDJHQWRUJRYHUQPHQWDJHQF\VRXUFHLVDVVXPHGWREHDFFXUDWHH[FHSWDVVSHFLILFDOO\ VWDWHGRWKHUZLVHLQ WKLV UHSRUW,QGHSHQGHQW YHULILFDWLRQ RIWKH DFFXUDF\ RUFRPSOHWHQHVVRIDOOLQIRUPDWLRQUHYLHZHGRUUHFHLYHGGXULQJWKHFRXUVHRIWKLVDVVHVVPHQWLVQRWPDGHDQGH[FOXGHGIURPWKHVFRSHRIZRUNIRUWKLVDVVHVVPHQW1RZDUUDQW\RUJXDUDQWHHLVPDGH RIWKHDFFXUDF\RUFRPSOHWHQHVVRILQIRUPDWLRQWKDWZDVREWDLQHGIURPRVWHQVLEO\NQRZOHGJHDEOHLQGLYLGXDOVUHJXODWRU\DJHQF\UHSUHVHQWDWLYHVRURWKHUVHFRQGDU\VRXUFHV5HJDUGOHVVRIWKHILQGLQJVVWDWHGLQWKLVUHSRUW+LOOPDQQLVQRWUHVSRQVLEOHIRUFRQVHTXHQFHVRUFRQGLWLRQVDULVLQJIURPIDFWVWKDWZHUHFRQFHDOHGZLWKKHOGRUQRWIXOO\GLVFORVHGDWWKHWLPHWKH DVVHVVPHQWZDVFRQGXFWHG7KLVUHSRUWGRHVQRWZDUUDQWDJDLQVWIXWXUHRSHUDWLRQVRUFRQGLWLRQVQRUGRHVLWZDUUDQWDJDLQVWRSHUDWLRQVRUFRQGLWLRQVSUHVHQWRIDW\SHRUDWDORFDWLRQQRWLQYHVWLJDWHG 7KHUHJXODWRU\ GDWDEDVH UHSRUW SURYLGHG LV EDVHG RQ DQ HYDOXDWLRQ RI WKH GDWD FROOHFWHG DQGFRPSLOHGE\DFRQWUDFWHGGDWDUHVHDUFKFRPSDQ\+LOOPDQQFDQQHLWKHUZDUUDQWQRUJXDUDQWHHWKHDFFXUDF\RUFRPSOHWHQHVVRIWKHLQIRUPDWLRQREWDLQHGIURPWKHUHJXODWRU\GDWDEDVHUHSRUWSURYLGHUGXULQJWKHFRXUVHRIWKLVDVVHVVPHQW 6XEVXUIDFHFRQGLWLRQVPD\GLIIHUIURPWKHFRQGLWLRQVLPSOLHGE\WKHVXUIDFHREVHUYDWLRQVDQGFDQRQO\EHUHOLDEO\HYDOXDWHGWKURXJKLQWUXVLYHWHFKQLTXHV5HDVRQDEOH HIIRUWV KDYH EHHQ PDGH GXULQJ WKLV DVVHVVPHQW WR LGHQWLI\ DERYHJURXQG DQGXQGHUJURXQGVWRUDJHWDQNVDQGDQFLOODU\HTXLSPHQW5HDVRQDEOHHIIRUWVDUHOLPLWHGWRLQIRUPDWLRQ JDLQHGIURPYLVXDOREVHUYDWLRQRIODUJHO\XQREVWUXFWHGDUHDVUHFRUGHGGDWDEDVHLQIRUPDWLRQKHOGLQSXEOLFUHFRUGDQGDYDLODEOHLQIRUPDWLRQJDWKHUHGIURPLQWHUYLHZV6XFKPHWKRGVPD\QRWLGHQWLI\VXUILFLDODQGVXEVXUIDFHIHDWXUHVWKDWPD\KDYHEHHQKLGGHQIURPYLHZGXHWRSDUNHGDXWRPRELOHVDQGRWKHUYHKLFOHVVQRZFRYHUYHJHWDWLYHJURZWKSDYHPHQWFRQVWUXFWLRQRUGHEULVSLOHVWRUDJHRULQFRUUHFWLQIRUPDWLRQIURPVRXUFHV 1RJXDUDQWHHH[SOLFLWRULPSOLHGLVPDGHWKDWWKHUHFRUGVSHUWDLQLQJWRKLVWRULFDORZQHUVKLSRURFFXSDQF\ZKLFKZHUHUHYLHZHGUHSUHVHQWDFRPSUHKHQVLYHRUSUHFLVHGHOLQHDWLRQRISDVW3URSHUW\RZQHUVKLSRUWHQDQF\IRUOHJDOSXUSRVHV 7KH$670(VWDQGDUGVWDWHVWKDWUHFRPPHQGDWLRQVDUHQRWUHTXLUHGWREHLQFOXGHGLQD 3KDVH,(6$UHSRUWKRZHYHUIXUWKHUWKDWUHFRPPHQGDWLRQVDUHDQDGGLWLRQDOVHUYLFHWKDWPD\EHXVHIXOLQWKH8VHU¶VDQDO\VLVRIODQGRZQHUOLDELOLW\SURWHFWLRQVRUEXVLQHVVHQYLURQPHQWDOULVNVDQGWKDWWKH8VHUVKRXOGFRQVLGHUZKHWKHUUHFRPPHQGDWLRQVIRUDGGLWLRQDOLQTXLULHVRURWKHUVHUYLFHVDUHGHVLUHG Hillmann Consulting LLC Phase I Environmental Site Assessment -12- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 5HFRPPHQGHGUHVSRQVHDFWLRQVRIIHUHGLQ6HFWLRQLIDQ\DUHSURYLGHGDVDQRSWLRQWRWKH&OLHQWDQGPD\KDYHWDNHQLQWRDFFRXQWWKH&OLHQW¶VUHODWLRQWRWKH6XEMHFW3URSHUW\DQGRUWKHLULQWHQGHGSXUSRVHRIWKLVDVVHVVPHQW,ILQFOXGHGLWLVQRWLQWHQGHGE\+LOOPDQQWRUHSUHVHQWWKHRQO\FRXUVHVRIDFWLRQRULQDFWLRQWRWDNH)XUWKHUPRUHLWLVHPSKDVL]HGWKDWDGGLWLRQDOUHVSRQVHDFWLRQVPD\EHFRPHDGYLVDEOHGHSHQGLQJRQWKHRXWFRPHRIWKHLQLWLDODFWLRQVWDNHQ+LOOPDQQ DGYLVHVWKDW&OLHQWDQGDQ\DGGLWLRQDODXWKRUL]HGUHO\LQJSDUWLHVDVVSHFLILHGRQWKHUHSRUW&RYHUDQG6HFWLRQRUYLDOHWWHURIUHOLDQFHH[WHQVLRQXQGHUWDNHFRQVXOWDWLRQZLWKOHJDOFRXQVHOIDPLOLDUZLWKHQYLURQPHQWDODQGUHDOHVWDWHODZZRXOGEHEHQHILFLDOWRWKHGHFLVLRQPDNLQJSURFHVVIRUWKHW\SHDQGWLPLQJRIDUHVSRQVHDFWLRQWRLGHQWLILHG5(&VRU%XVLQHVV(QYLURQPHQWDO5LVNVLIDQ\ 'XHWRWKHOLPLWHGQDWXUHRIRXUUHYLHZRISRWHQWLDO%XVLQHVV(QYLURQPHQWDO5LVNVWKH8VHUVRIWKHUHSRUWVKRXOGFRQVLGHUZKHWKHUWRWDNHDGGLWLRQDODFWLRQVWRIXUWKHUGHILQHSURSHUO\PDQDJHDQGRUPLWLJDWHSRWHQWLDO%(5V 7KH8VHUVDVVXPHVUHVSRQVLELOLW\IRUEXVLQHVVGHFLVLRQVWKDWLWPDNHVXWLOL]LQJLQIRUPDWLRQLQWKHUHSRUWSURYLGHGE\+LOOPDQQ+LOOPDQQVKDOOQRWEHUHVSRQVLEOHIRUDQ\FRQFOXVLRQVLQWHUSUHWDWLRQVDQGRUGHFLVLRQVRIWKH8VHUV,QWKHHYHQWRIDQ\FRQIOLFWEHWZHHQWKHWHUPVDQGFRQGLWLRQVRIWKLVUHSRUWDQGWKHWHUPVDQG FRQGLWLRQVRIWKHFRQVXOWLQJVHUYLFHVDJUHHPHQWIRUWKLVSURMHFWWKHFRQVXOWLQJVHUYLFHVDJUHHPHQWVKDOOFRQWURO Hillmann Consulting LLC Phase I Environmental Site Assessment -13- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 3.0 USER PROVIDED INFORMATION 7KHWHUP³8VHU´LVGHILQHGE\$670DVWKHSDUW\VHHNLQJWRXVH3UDFWLFH(WRFRPSOHWHDQHQYLURQPHQWDOVLWHDVVHVVPHQWRIWKH6XEMHFW3URSHUW\VSHFLILFDOO\WKHHQWLW\RUHQWLWLHVQDPHGRQWKHIURQWFRYHUWRZKLFKWKHUHSRUWKDVEHHQDGGUHVVHG 3.1 Environmental Lien and Activity and Use Limitation (AUL) Search 7KH8VHUSURYLGHG+LOOPDQQZLWKWKHUHVXOWVRIDQHQYLURQPHQWDOOLHQDQG$8/VHDUFKIRUWKH 6XEMHFW3URSHUW\1RHQYLURQPHQWDOOLHQVRU$8/VZHUHLQGLFDWHGE\WKHVHDUFK 3.2 Prior Environmental Reports/Documentation 1RSULRUHQYLURQPHQWDOUHSRUWVGRFXPHQWDWLRQZHUHSURYLGHG 3.3 User Responsibilities 6HFWLRQRIWKH$670(VWDQGDUGGHVFULEHVFHUWDLQWDVNVUHTXLUHGWREHSHUIRUPHGE\WKHUHSRUW8VHULQRUGHUWRTXDOLI\IRUODQGRZQHUOLDELOLW\SURWHFWLRQVWR&(5&/$OLDELOLW\7RDVVLVWWKH UHSRUW 8VHU WR PHHW WKHVH UHTXLUHPHQWV WKH $670 (VWDQGDUGUHFRPPHQGV DTXHVWLRQQDLUH RI LQTXLULHV8VHU 4XHVWLRQQDLUHVSHFLILHG LQ &)5 DQGEHSURYLGHGWRWKHRULJLQDOUHSRUW8VHU7KHIROORZLQJLVDVXPPDU\RIWKH 8VHU¶VUHVSRQVH Question: Yes/No: Detail: Environmental liens that are filed or recorded against the property:'LGDVHDUFKRIUHFRUGHGODQGWLWOHUHFRUGVLGHQWLI\DQ\HQYLURQPHQWDOOLHQVILOHGRUUHFRUGHGDJDLQVWWKHSURSHUW\XQGHUIHGHUDOWULEDOVWDWHRUORFDOODZ" 1R Activity and use limitations that are in place on the property or that have been filed or recorded against the property: 'LGDVHDUFKRIUHFRUGHGODQGWLWOHUHFRUGVRUMXGLFLDOUHFRUGVZKHUHDSSURSULDWHLGHQWLI\DQ\$8/VVXFKDVHQJLQHHULQJFRQWUROVODQGXVHUHVWULFWLRQVRULQVWLWXWLRQDOFRQWUROVWKDWDUHLQ SODFHDWWKHSURSHUW\DQGRUKDYHEHHQILOHGRUUHFRUGHGDJDLQVWWKHSURSHUW\XQGHUIHGHUDOWULEDOVWDWHRUORFDOODZ" 1R Specialized knowledge or experience of the person seeking to qualify for the LLP:'R\RXKDYHDQ\VSHFLDOL]HGNQRZOHGJHRUH[SHULHQFHUHODWHGWRWKHSURSHUW\RUQHDUE\SURSHUWLHV")RUH[DPSOHDUH\RXLQYROYHGLQWKHVDPHOLQHRIEXVLQHVVDVWKHFXUUHQWRUIRUPHURFFXSDQWVRIWKHSURSHUW\RUDQDGMRLQLQJSURSHUW\VRWKDW\RXZRXOGKDYHVSHFLDOL]HGNQRZOHGJHRIWKHFKHPLFDOVDQGSURFHVVHVXVHGE\WKLVW\SHRIEXVLQHVV" <HV Relationship of the purchase price to the fair market value of the property if it were not contaminated: 'RHVWKHSXUFKDVHSULFHEHLQJSDLGIRUWKLVSURSHUW\UHDVRQDEO\ UHIOHFWWKHIDLUPDUNHWYDOXHRIWKHSURSHUW\",I\RXFRQFOXGHWKDWWKHUHLVDGLIIHUHQFHKDYH\RXFRQVLGHUHGZKHWKHUWKHORZHU 1$Not Applicable Hillmann Consulting LLC Phase I Environmental Site Assessment -14- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California Question: Yes/No: Detail: SXUFKDVHSULFHLVEHFDXVHFRQWDPLQDWLRQLVNQRZQRUEHOLHYHGWREHSUHVHQWDWWKHSURSHUW\" Commonly Known or Reasonably Ascertainable Information: $UH\RXDZDUHRIFRPPRQO\NQRZQRUUHDVRQDEO\DVFHUWDLQDEOHLQIRUPDWLRQDERXWWKHSURSHUW\WKDWZRXOGKHOSWKHHQYLURQPHQWDOSURIHVVLRQDOWRLGHQWLI\FRQGLWLRQVLQGLFDWLYHRIUHOHDVHVRUWKUHDWHQHGUHOHDVHV")RUH[DPSOH 'R\RXNQRZWKHSDVWXVHVRIWKHSURSHUW\" <HV 'R\RXNQRZRIVSHFLILFFKHPLFDOVWKDWDUHSUHVHQWRUZHUHRQFHSUHVHQWDWWKHSURSHUW\" 1R 'R\RXNQRZRIVSLOOVRURWKHUFKHPLFDOUHOHDVHVWKDWKDYHWDNHQSODFHDWWKHSURSHUW\" 1R 'R\RXNQRZRIDQ\HQYLURQPHQWDOFOHDQXSVWKDWKDYHWDNHQSODFHDWWKHSURSHUW\"1R The degree of obviousness of the presence or likely presence of contamination at the property, and the ability to detect the contamination by appropriate investigation: %DVHGRQ\RXUNQRZOHGJHDQGH[SHULHQFHUHODWHGWRWKHSURSHUW\DUHWKHUHDQ\REYLRXVLQGLFDWRUVWKDWSRLQWWRWKHSUHVHQFHRU OLNHO\SUHVHQFHRIUHOHDVHVDWWKHSURSHUW\" 1R Litigation/Administrative Proceedings/Government Notices $VWKH8VHURIWKLV(6$GR\RXKDYHNQRZOHGJHRIDQ\SHQGLQJWKUHDWHQHGRUSDVWOLWLJDWLRQUHOHYDQWWRKD]DUGRXVVXEVWDQFHVRUSHWUROHXPSURGXFWVLQRQRUIURPWKHSURSHUW\DQ\SHQGLQJWKUHDWHQHGRUSDVWDGPLQLVWUDWLYHSURFHHGLQJVUHOHYDQWWRKD]DUGRXVVXEVWDQFHVRUSHWUROHXPSURGXFWVLQRQRUIURPWKHSURSHUW\DQGDQ\QRWLFHVIURPDQ\JRYHUQPHQWDOHQWLW\UHJDUGLQJDQ\SRVVLEOHYLRODWLRQRIHQYLURQPHQWDOODZVRUSRVVLEOHOLDELOLW\UHODWLQJWRKD]DUGRXVVXEVWDQFHVRUSHWUROHXPSURGXFWV 1R NR-no response 3.4 User’s Reason for Performing Phase I ESA 7KH8VHUGLGQRWLQGLFDWHWKHSXUSRVHRIWKHDVVHVVPHQW,QDFFRUGDQFHZLWK$670(LWLV DVVXPHGWKDWWKH3KDVH,(6$ZDVEHLQJSHUIRUPHGLQRUGHUWRTXDOLI\IRUODQGRZQHUOLDELOLW\ SURWHFWLRQWR&(5&/$OLDELOLW\ Hillmann Consulting LLC Phase I Environmental Site Assessment -15- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 4.0 RECORDS REVIEW 4.1 Environmental Information Physical Setting Source Discussion 86*6PLQXWH7RSRJUDSKLF0DS'DWD('5*HRFKHFN3K\VLFDO6HWWLQJ6RXUFH$GGHQGXP 7KH3URSHUW\OLHVDWDQHOHYDWLRQRIDSSUR[LPDWHO\IHHWDERYHPHDQVHDOHYHO$QLQWHUSUHWDWLRQRIWRSRJUDSKLFFRQWRXUOLQHVDVZHOODVDUHYLHZRIWKH('5*HRFKHFN*HQHUDO7RSRJUDSKLF*UDGLHQWVXJJHVWHGWHUUDLQVORSLQJGRZQZDUGWRZDUGVWKHVRXWKVRXWKZHVW7KHUHLVQRGRZQJUDGLHQWERG\RIZDWHU 86'$6&66RLO'DWD('5*HRFKHFN3K\VLFDO6HWWLQJ6RXUFH$GGHQGXP 7KHVRLOW\SHDWWKH6XEMHFW3URSHUW\LVFODVVLILHGDV³7XMXQJD´7KLVVRLOW\SHLVGHVFULEHGDVVRLOVZLWKJUDYHO\ORDP\VDQGWH[WXUHVKLJKLQILOWUDWLRQUDWHVZHOOGUDLQHGWRH[FHVVLYHO\GUDLQHGVDQGVDQGJUDYHOV *HRORJLF'DWD ('5*HRFKHFN3K\VLFDO6HWWLQJ6RXUFH$GGHQGXP &HQR]RLF(UD4XDWHUQDU\6\VWHP4XDWHUQDU\6HULHV 3ULRU(QY5HSRUWV6HFWLRQ1RSULRUUHSRUWVZHUHDYDLODEOHIRUUHYLHZ $GGLWLRQDO6RXUFHV'DWD1RDGGLWLRQDOSK\VLFDOVHWWLQJVRXUFHVRUGDWDZDVREWDLQHG *URXQGZDWHU)ORZ 'LVFXVVLRQ %DVHGRQDUHYLHZRIWKHDERYHLQIRUPDWLRQDVZHOODVREVHUYDWLRQRIWKHVLWHWKHGLUHFWLRQ RIVKDOORZJURXQGZDWHUIORZDWWKHVLWHLVLQIHUUHGWREHWRZDUGVWKHVRXWKVRXWKZHVW Federal, State and Tribal Environmental Record Sources 6WDQGDUGJRYHUQPHQWUHFRUGVZHUHREWDLQHGDQGUHYLHZHGSULPDULO\YLDDWKLUGSDUW\UHJXODWRU\GDWDEDVHUHSRUWWLWOHG('55DGLXV0DS5HSRUWSUHSDUHGE\(QYLURQPHQWDO'DWD5HVRXUFHVRI6KHOWRQ&77KHUHSRUWSURYLGHGJRYHUQPHQWUHFRUGVIURPWKHVWDQGDUGHQYLURQPHQWDOUHVRXUFHV DQGZLWKLQPLQLPXPVHDUFKGLVWDQFHVVSHFLILHGE\6HFWLRQ7DEOHRIWKH$670( DQGZHUHUHYLHZHGIRUWKHSXUSRVHRILGHQWLI\LQJSRWHQWLDO5(&VLQFRQQHFWLRQZLWKWKH6XEMHFW3URSHUW\$GGLWLRQDOGHWDLORIWKHVRXUFHDQGVLJQLILFDQFHRIWKHUHJXODWRU\GDWDEDVHVFDQEHIRXQGLQWKHUHJXODWRU\GDWDEDVHUHSRUWLQ$SSHQGL[(+LOOPDQQKDVDOVRLQFOXGHGGLVFXVVLRQRIUHFRUGVSHUWDLQLQJWRWKH6XEMHFW3URSHUW\IURPRWKHUJRYHUQPHQWUHFRUGVRXUFHVQRWVSHFLILFDOO\OLVWHG XQGHU7DEOHDVDSSOLFDEOH 5HSRUWHGGLVWDQFHVIRUDGMRLQLQJSURSHUW\OLVWLQJVLIDSSOLFDEOHDUHDSSUR[LPDWHDQGLQGLFDWLYHRIWKHSUHVHQFHRIDSXEOLFURDGZD\RUULJKWRIZD\EHWZHHQWKHDGMRLQLQJVLWHDQG3URSHUW\ 7KH UHSRUWHG JUDGLHQWV KDYH EHHQ HVWLPDWHG EDVHG RQ D QXPEHU RI IDFWRUV LQFOXGLQJ EXW QRW QHFHVVDULO\OLPLWHGWRILHOGREVHUYDWLRQUHYLHZRIWRSRJUDSKLFPDSVGDWDEDVHOLVWLQJGHWDLOVDQGRUVLWHVSHFLILFJHRWHFKQLFDOGDWD/LPLWHGDQDO\VLVRIWKHGHWDLOVRIRQVLWHDGMRLQLQJDQGYLFLQLW\GDWDEDVHVLWHVZDVFRQGXFWHGWRLGHQWLI\SRWHQWLDOVRXUFHVRIVXEVXUIDFHYDSRUHQFURDFKPHQW7KLVUHYLHZZDVEDVHGRQHOHPHQWV RIWKH$670³6WDQGDUG*XLGHIRU9DSRU(QFURDFKPHQW6FUHHQLQJRQ3URSHUW\,QYROYHGLQ5HDO(VWDWH7UDQVDFWLRQV´$670(DQGDOVRRQHOHPHQWVRI³0HWKRGRORJ\IRU,GHQWLI\LQJWKH$UHDRI&RQFHUQ$URXQGD3URSHUW\3RWHQWLDOO\,PSDFWHGE\9DSRU0LJUDWLRQIURP1HDUE\&RQWDPLQDWHG6RXUFHV´%XRQLFRUH6$:0$9LFLQLW\GDWDEDVHVLWHVSHUWDLQLQJWR Hillmann Consulting LLC Phase I Environmental Site Assessment -16- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California QRQSHWUROHXP SURGXFW UHOHDVHV ZLWKLQ IHHW RI WKH 6XEMHFW 3URSHUW\ LQ WKH XSJUDGLHQWGLUHFWLRQIHHWRIWKH6XEMHFW3URSHUW\LQWKHFURVVJUDGLHQWGLUHFWLRQDQGIHHWRIWKH6XEMHFW3URSHUW\LQWKHGRZQJUDGLHQWGLUHFWLRQDQGYLFLQLW\GDWDEDVHVLWHVSHUWDLQLQJWRSHWUROHXPSURGXFWUHOHDVHVZLWKLQIHHWRIWKH6XEMHFW3URSHUW\LQWKHXSJUDGLHQWGLUHFWLRQIHHWRIWKH6XEMHFW3URSHUW\LQWKHFURVVJUDGLHQWGLUHFWLRQDQGIHHWRIWKH6XEMHFW3URSHUW\LQWKHGRZQJUDGLHQW GLUHFWLRQZHUHUHYLHZHGWRLGHQWLI\DFWLYHFRQWDPLQDWLRQVLWHVZLWKWKHSRWHQWLDOWRDIIHFWVXEVXUIDFHYDSRUFRQGLWLRQVDWWKH6XEMHFW3URSHUW\7KHSRWHQWLDOIRUYDSRUHQFURDFKPHQWZDVFRQVLGHUHGLQDVVHVVLQJZKHWKHURUQRWD5(&H[LVWVLQFRQQHFWLRQZLWKWKH6XEMHFW3URSHUW\ZKHQUHYLHZLQJDSSOLFDEOHVLWHVZLWKLQWKRVHGLVWDQFHV 5HJXODWRU\GDWDEDVHVLWHVZLWKDFWLYHSHWUROHXPRUQRQSHWUROHXPUHOHDVHVWKDWDUHFRQVLGHUHGWRFRQVWLWXWHDYDSRUHQFURDFKPHQWFRQGLWLRQ9(&WRWKH6XEMHFW3URSHUW\LIDQ\DUHLGHQWLILHGDQGGLVFXVVHGLQWKLVVHFWLRQ7KH('55DGLXV0DSUHSRUWLVDWWDFKHGLQ$SSHQGL[( Property Listings 7KHIROORZLQJOLVWLQJVRIWKH6XEMHFW3URSHUW\ZHUHLGHQWLILHG Name/Address: 7UDQV:HVW7UXFN&HQWHU9DOOH\%RXOHYDUG Database(s):),1'613'(6DQG&,:46 Data Discussion: 7KH),1'6OLVWLQJLQGLFDWHGD5HJLVWU\,'RI7KH13'(6OLVWLQJLQGLFDWHGD³&RQVWUXFWLRQ´ GDWDEDVH ZLWK D ³7HUPLQDWHG´ VWDWXV 7KH&,:46 OLVWLQJ LQGLFDWHG D³&RQVWUXFWLRQ±FRPPHUFLDO´ VWRUPZDWHU FRQVWUXFWLRQ ZLWK D WHUPLQDWLRQ GDWH DV RI . REC Discussion: %DVHGRQWKHGHWDLOVSURYLGHGDERYHD5(&LVQRWVXVSHFWHGLQFRQQHFWLRQZLWKWKH3URSHUW\ VEC Discussion: %DVHGRQWKHDYDLODEOHGDWDD9(&LVQRWVXVSHFWHG Name/Address: *UHDW'DQH7UDLOHUV9DOOH\%RXOHYDUG Database(s):5&5$1RQ*HQ1/5+:76+$8/(56 Data Discussion: 7KH5&5$1RQ*HQ1/5OLVWLQJLQGLFDWHGWKH3URSHUW\LVQRWOLVWHGRQDKD]DUGRXVZDVWHJHQHUDWRU ZLWKQR YLRODWLRQV QRWHG 7KH +:76 OLVWLQJ LQGLFDWHGD ³7UXFN 7UDLOHU0DQXIDFWXULQJ´ZLWKDQ³,QDFWLYH´GDWHDVRI7KH+$8/(56OLVWLQJLQGLFDWHGWKH3URSHUW\QDPHDGGUHVVDIDFLOLW\,'RIDQGDQ³$FWLYH´VWDWXV REC Discussion: %DVHGRQWKHGHWDLOVSURYLGHGDERYHD5(&LVQRWVXVSHFWHGLQFRQQHFWLRQZLWKWKH3URSHUW\ VEC Discussion: %DVHGRQWKHDYDLODEOHGDWDD9(&LVQRWVXVSHFWHG Adjoining Property Listings 7KHIROORZLQJDGMRLQLQJSURSHUW\OLVWLQJVZHUHLGHQWLILHG Name/Address: 7UXFN7RZQ&KHUU\$YHQXH Database(s): /867 Distance in feet: Direction:6(Gradient: 'RZQ&URVV Data Discussion: 7KH /867OLVWLQJ LQGLFDWHGWKHVRLO ZDV FRQWDPLQDWHG DW WKH VLWH ZLWK WRWDO SHWUROHXPK\GURFDUERQVIURPDOHDNLQJ867ZLWKDOHDNILUVWEHLQJGHWHFWHGLQ6HSWHPEHU7KHVLWHZDVJUDQWHGUHJXODWRU\FORVXUHZLWKD1R)XUWKHU$FWLRQ/HWWHUDVRI0D\0XOWLSOHHQYLURQPHQWDOVLWHDVVHVVPHQWVKDGEHHQFRQGXFWHGRQVLWHVLQFHWKHODWHVVRLODQGVRLOJDVVDPSOHVLQGLFDWHGLQFUHDVLQJOHYHOVRI73+GLHVHOGXULQJWKHHDUO\V7KHVLWHZDV Hillmann Consulting LLC Phase I Environmental Site Assessment -17- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California SODFHGRQD&RUUHFWLYH$FWLRQ3ODQLQDQGVRLOYDSRUVDPSOLQJZDVFRQGXFWHGLQ-XO\/DERUDWRU\DQDO\VLVLQGLFDWHG73+JEHQ]HQHDQG07%(FRQFHQWUDWLRQVRIDQGSSP,Q$XJXVWIRXUVHWVRIGXDOFRPSOHWLRQVRLOYDSRUH[WUDFWLRQZHOOVZHUHLQVWDOOHGRQVLWHDQG9RODWLOHRUJDQLFFRPSRXQGV92&VZHUHQRWGHWHFWHGLQVRLOJDVVDPSOHVFROOHFWHGLQWKHDUHDRIWKHIRUPHU867KRZHYHU07%(ZDVGHWHFWHGDWDFRQFHQWUDWLRQRIXSWRSSPY$GGLWLRQDOO\LQ0DUFKDGD\69(HYHQWZDVFRQGXFWHGWRGHPRQVWUDWHDIXUWKHUUHGXFWLRQRIVRLOJDVSDUWLFXODUO\07%($WRWDORIOEVKDYHEHHQUHFRYHUHGGXULQJWKH69(DFWLYLWLHVEHWZHHQDQGKRZHYHUWKH1)$OHWWHUFRQFOXGHGWKHIROORZLQJ³no the vertical extent of the TPH-diesel affected soil was not defined due to the cost to define the contamination beyond the detected 180 feet bgs and the depth of groundwater being greater than 300 feet bgs.” REC Discussion: %DVHGRQWKHGHWDLOVSURYLGHGDERYHD5(&LVQRWVXVSHFWHGLQFRQQHFWLRQZLWKWKH3URSHUW\ VEC Discussion: %DVHGRQWKHDYDLODEOHGDWDD9(&LVQRWVXVSHFWHG Name/Address: 5XVK7UXFN&HQWHUV±8VHG7UXFN6DOHV9DOOH\%RXOHYDUG Database(s): +:76 &(56 +$= :$67( +$=1(7 6$1 %(51 & 3(05,7 &(56 DQG5&5$1RQ*HQ1/5 Distance in feet: Direction::Gradient: 'RZQ&URVV Data Discussion: 7KH +$=1(7OLVWLQJ LQGLFDWHG PXOWLSOH WRQV RI ³RWKHU RUJDQLF VROLGV´ DQG ³XQVSHFLILHGDTXHRXVVROXWLRQV´ZHUHVWRUHGEXONHGDQGRUWUDQVIHUUHGRIIVLWHLQDQG7KH+:76OLVWLQJLQGLFDWHGWKHVLWHLVOLVWHGRQWKH³+D]DUGRXV:DVWH*HQHUDWRU´GDWDEDVHZLWKD&(56,'RI7KH6$1%(51&23(50,7OLVWLQJLQGLFDWHGD³VPDOOTXDQWLW\JHQHUDWRU´ZLWKDQH[SLUDWLRQGDWHDVRI7KH&(56OLVWLQJLQGLFDWHGPXOWLSOH DGPLQLVWUDWLYHYLRODWLRQV2QHYLRODWLRQLQGLFDWHGDIDLOXUHWRHVWDEOLVKD&RQWLQJHQF\3ODQIDLOXUHRIDJHQHUDWRURIKD]DUGRXVZDVWHWKDWPHHWVWKHFRQGLWLRQVWREHWUDQVSRUWHGRQDFRQVROLGDWHGPDQLIHVWWRFRPSO\ZLWKRQHRUPRUHRIWKHUHTXLUHGFRQVROLGDWHGPDQLIHVWLQJSURFHGXUHV DQG UHWDLQ FRSLHV RI UHFHLSWV IRUWKUHH \HDUV DQG IDLOXUH WR FRPSOHWH DQGHOHFWURQLFDOO\VXEPLWKD]DUGRXVPDWHULDOLQYHQWRU\LQIRUPDWLRQIRUDOOUHSRUWDEOHKD]DUGRXVPDWHULDOVRQVLWHDWRUDERYHUHSRUWDEOHTXDQWLWLHV+RZHYHUPRVWRIWKHYLRODWLRQVDSSHDUWR EHUHODWLYHO\PLQRULQVFDOHDQGGRQRWLQGLFDWHD5(&ZLWKFRQQHFWLRQWRWKH3URSHUW\7KH5&5$1RQ*HQ1/5OLVWLQJLQGLFDWHGWKHVLWHLVQRWRQDKD]DUGRXVZDVWHJHQHUDWRUGDWDEDVHZLWKQRYLRODWLRQVQRWHG REC Discussion: %DVHGRQWKHGHWDLOVSURYLGHGDERYHD5(&LVQRWVXVSHFWHGLQFRQQHFWLRQZLWKWKH3URSHUW\ VEC Discussion: %DVHGRQWKHDYDLODEOHGDWDD9(&LVQRWVXVSHFWHG Name/Address: 6ZLIW7UDQVSRUWDWLRQ9DOOH\%RXOHYDUG Database(s): $678675&5$1RQ*HQ1/5&(56+$=:$67(&(567$1.6&+5,066$1%(51&23(50,7&(565&5$1RQ*HQ1/5 Distance in feet: Direction:1Gradient: 8S Data Discussion: 7KH$67OLVWLQJLQGLFDWHGWKHVLWHQDPHDGGUHVVDQGDQ(3$,'RI&$7KH867OLVWLQJ LQGLFDWHG VLWH QDPH DGGUHVV ZLWK D )DFLOLW\ ,' RI DQG QR RWKHU IXUWKHUSHUPDQHQWLQIRUPDWLRQSURYLGHG7KH&(56+$=:$67(OLVWLQJLQGLFDWHGWKHVLWHLVOLVWHGRQWKH³+D]DUGRXV:DVWH*HQHUDWRU´GDWDEDVHZLWKQRYLRODWLRQQRWHG7KH&(567$1.6 OLVWLQJLQGLFDWHGWKHVLWHLVOLVWHGRQWKH³8QGHUJURXQG6WRUDJH7DQN´GDWDEDVH7KH&+5,06OLVWLQJLQGLFDWHG³battery acid leaked within a trailer and less than a couple of ounces reached the ground. The release is contained, cleanup is en route, and no waterways were impacted”,ZLWKDQ,QFLGHQWGDWHDVRI7KH6$1%(51&23(50,7OLVWLQJLQGLFDWHGD³VPDOOTXDQWLW\JHQHUDWRU´ZLWKDQ³$FWLYH´VWDWXV7KH:'6OLVWLQJLQGLFDWHGDQ³$FWLYH´ “Industrial - Facility that treats and/or disposes of liquid or semisolid wastes from any servicing, producing, manufacturing or processing operation of whatever nature, including mining, gravel washing, geothermal operations, air conditioning, ship building and repairing, oil production, storage and disposal operations, water pumping.”7KH&(56OLVWLQJLQGLFDWHGPXOWLSOHDGPLQLVWUDWLYHYLRODWLRQV2QHYLRODWLRQLQGLFDWHGDIDLOXUHWRQRWHDQDFFXPXODWLRQ VWDUWGDWHRQODEHOVIDLOXUHWRUHSRUWDUHOHDVHRUWKUHDWHQHGUHOHDVHRIDKD]DUGRXVPDWHULDOWRWKHXQLILHGSURJUDPDJHQF\DQGWR2(6DQGIDLOXUHWRVXEPLWWKH'HVLJQDWHG8QGHUJURXQG Hillmann Consulting LLC Phase I Environmental Site Assessment -18- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 6WRUDJH 7DQN 2SHUDWRU ,GHQWLILFDWLRQ )RUP ZLWKLQ GD\V RI LQVWDOOLQJ D 867 V\VWHP+RZHYHUPRVWRIWKHYLRODWLRQVDSSHDUWREHUHODWLYHO\PLQRULQVFDOHDQGGRQRWLQGLFDWHD5(&ZLWKFRQQHFWLRQWRWKH3URSHUW\7KH5&5$1RQ*HQ1/5OLVWLQJLQGLFDWHGWKHVLWHLVQRWRQDKD]DUGRXVZDVWHJHQHUDWRUGDWDEDVHZLWKQRYLRODWLRQVQRWHG REC Discussion: %DVHGRQWKHGHWDLOVSURYLGHGDERYHD5(&LVQRWVXVSHFWHGLQFRQQHFWLRQZLWKWKH3URSHUW\ VEC Discussion: %DVHGRQWKHDYDLODEOHGDWDD9(&LVQRWVXVSHFWHG Surrounding Area Findings 7KHIROORZLQJLVDGLVFXVVLRQRIQRQDGMRLQLQJVLWHVLGHQWLILHGDVORFDWHGZLWKLQWKH$670VSHFLILHGVHDUFKGLVWDQFHVXUURXQGLQJWKH6XEMHFW3URSHUW\,QRUGHUWRNHHSWKLVGLVFXVVLRQLQIRUPDWLYHDQGFRQFLVHGLVFXVVLRQVLVDUHSURYLGHGRIWKHOLVWHGVLWHVIRUHDFKGDWDEDVHFDWHJRU\WKDWDSSHDUVPRVWOLNHO\WRLPSDFWWKH6XEMHFW3URSHUW\EDVHGRQGLVWDQFHDUHDWRSRJUDSK\DQGRUUHJXODWRU\VWDWXV/LVWLQJVRIVLWHVZLWKLQWKHDSSOLFDEOHVHDUFKGLVWDQFHVQRWVSHFLILFDOO\GLVFXVVHGEHORZZHUH UHYLHZHGDQGFRQFOXGHGQRWWREH5(&VLQFRQQHFWLRQZLWKWKH6XEMHFW3URSHUW\RU9(&VEDVHGRQYDULRXVIDFWRUVLQFOXGLQJGLVWDQFHDUHDWRSRJUDSK\NQRZQRULQIHUUHGJURXQGZDWHUIORZGLUHFWLRQDQGRUUHJXODWRU\VWDWXV Federal NPL# of sites:Search Distance: PLOH Notable Listing: 1RQH Distance in feet: Direction:Gradient: Data Discussion: REC Discussion: VEC Discussion: Federal Delisted NPL# of sites:Search Distance: PLOH Notable Listing: 1RQH Distance in feet: Direction:Gradient: Data Discussion: REC Discussion: VEC Discussion: Federal SEMS# of sites:Search Distance: òPLOH Notable Listing: 1RQH Distance in feet: Direction:Gradient: Data Discussion: REC Discussion: VEC Discussion: Federal SEMS-ARCHIVE# of sites:Search Distance: òPLOH Notable Listing: %DQDQD6WUHHW3LW%ORFNRI%DQDQD Distance in feet: Direction:1(Gradient: 8S Data Discussion: 7KH6(06$5&+,9(OLVWLQJLQGLFDWHGWKH³6LWHGRHVQRWTXDOLI\IRUWKH13/EDVHGRQH[LVWLQJ LQIRUPDWLRQ´ REC Discussion: %DVHGRQWKHGHWDLOVSURYLGHGDERYHD5(&LVQRWVXVSHFWHGLQFRQQHFWLRQZLWKWKH3URSHUW\ VEC Discussion: %DVHGRQWKHDYDLODEOHGDWDD9(&LVQRWVXVSHFWHG Hillmann Consulting LLC Phase I Environmental Site Assessment -19- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California Federal CORRACTS# of sites:Search Distance: PLOH Notable Listing: (ULFNVRQ,QF6ORYHU$YHQXH Distance in feet: Direction::6:Gradient: 'RZQ Data Discussion: 7KH&255$&76OLVWLQJLQGLFDWHGDFRUUHFWLYHDFWLRQ³5)$&RPSOHWHG$VVHVVPHQWZDVD3$SOXV´DQG³6WDELOL]DWLRQPHDVXUHGHYDOXDWLRQIDFLOLW\QRWDPHQDEOHWRVWDELOL]DWLRQ´KRZHYHUQRRWKHUSHUPDQHQWLQIRUPDWLRQZDVSURYLGHG REC Discussion: %DVHGRQWKHGHWDLOVSURYLGHGDERYHD5(&LVQRWVXVSHFWHGLQFRQQHFWLRQZLWKWKH3URSHUW\ VEC Discussion: %DVHGRQWKHDYDLODEOHGDWDD9(&LVQRWVXVSHFWHG Federal RCRA-TSD# of sites:Search Distance: òPLOH Notable Listing: 1RQH Distance in feet: Direction:Gradient: Data Discussion: REC Discussion: VEC Discussion: State/Tribal SUPERFUND & HAZARDOUS WASTE # of sites:Search Distance: PLOH Notable Listing: &DOLIRUQLD6WUHHO,QGXVWULHV6DQ%HUQDUGLQR Distance in feet: Direction:1:Gradient: 8S Data Discussion: 7KH(19,526725OLVWLQJLQGLFDWHGWKDWVRLODWWKHVLWHZDVFRQWDPLQDWHGZLWK3RO\FKORULQDWHGELSKHQ\OV 3&%V DQG 3RO\QXFOHDU DURPDWLF K\GURFDUERQV 3$+ IURP KLVWRULFDOPDQXIDFWXULQJRSHUDWLRQV7KHVLWHLVOLVWHGRQWKH³'76&6LWH&OHDQXS3URJUDP´ZLWK³5HPHGLDO $FWLYLWLHV´ KRZHYHU LW DSSHDUV WKDW WKH FRQWDPLQDWHG VRLO ZDV H[FDYDWHGDQGGLVSRVHGRIIVLWH$1R)XUWKHU$FWLRQ/HWWHU1)$ZDVJUDQWHGDVRI REC Discussion: %DVHGRQWKHGHWDLOVSURYLGHGDERYHD5(&LVQRWVXVSHFWHGLQFRQQHFWLRQZLWKWKH3URSHUW\ VEC Discussion: %DVHGRQWKHDYDLODEOHGDWDD9(&LVQRWVXVSHFWHG State/Tribal LANDFILL/SOLID WASTE DISPOSAL # of sites:Search Distance: òPLOH Notable Listing: 5DQFKR'LVSRVDO,QF&KHUU\$YHQXH Distance in feet: Direction:11(Gradient: 8S Data Discussion: 7KH6:)/) OLVWLQJ LQGLFDWHG WKDW VRLO ZDV FRQWDPLQDWHG DW WKH VLWH ZLWK 73+J IURP DKLVWRULFDOOHDNLQJXQGHUJURXQGVWRUDJHWDQN867KRZHYHULWDSSHDUVWKDWWKHFRQWDPLQDWHG VRLOZDVH[FDYDWHGDQGGLVSRVHGRIIVLWH7KHVLWHZDVJUDQWHGD1R)XUWKHU$FWLRQ1)$OHWWHUDVRI REC Discussion: %DVHGRQWKHGHWDLOVSURYLGHGDERYHD5(&LVQRWVXVSHFWHGLQFRQQHFWLRQZLWKWKH3URSHUW\ VEC Discussion: %DVHGRQWKHDYDLODEOHGDWDD9(&LVQRWVXVSHFWHG State/Tribal LEAKING STORAGE TANKS # of sites:Search Distance: òPLOH Notable Listing: )OHHWFUHZ9DOOH\%RXOHYDUG Distance in feet: Direction:1:Gradient: 8S Data Discussion: 7KH/867OLVWLQJLQGLFDWHGWKDWVRLOZDVFRQWDPLQDWHGDWWKHVLWHZLWK73+GZLWKJDOORQVRIOLTXLGQRQ5&5$KD]DUGRXVZDVWHOLTXLGVUHPRYHGDQGWUDQVSRUWHGWRDUHF\FOLQJIDFLOLW\GXULQJ WKH 867 DQG GLVSHQVHU LVODQG UHPRYDOV DQG H[FDYDWLRQ DFWLYLWLHV0XOWLSOHHQYLURQPHQWDODQGUHPHGLDODFWLYLWLHVKDGRFFXUUHGDWWKHVLWHVLQFHDQGWKHVLWHZDVJUDQWHGD1R)XUWKHU$FWLRQOHWWHUDVRI REC Discussion: %DVHGRQWKHGHWDLOVSURYLGHGDERYHD5(&LVQRWVXVSHFWHGLQFRQQHFWLRQZLWKWKH3URSHUW\ VEC Discussion: %DVHGRQWKHDYDLODEOHGDWDD9(&LVQRWVXVSHFWHG Hillmann Consulting LLC Phase I Environmental Site Assessment -20- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California State/Tribal VOLUNTARY CLEANUP SITES # of sites:Search Distance: òPLOH Notable Listing: 1RQH Distance in feet: Direction:Gradient: Data Discussion: REC Discussion: VEC Discussion: State/Tribal BROWNFIELD SITES # of sites:Search Distance: òPLOH Notable Listing: 1RQH Distance in feet: Direction:Gradient: Data Discussion: REC Discussion: VEC Discussion: UNMAPPED/ORPHAN LIST SITES +LOOPDQQKDVDOVRUHYLHZHGDOLVWRIXQPDSSHGVLWHVDND³2USKDQ/LVW´VLWHVLQGLFDWHGE\WKHGDWDEDVHUHSRUW8QPDSSHGVLWHVWKDWZHUHLGHQWLILHGDVIDOOLQJZLWKLQDQDSSOLFDEOHVSHFLILFVHDUFKGLVWDQFHRUZDUUDQWLQJGLVFXVVLRQKDYHHLWKHUEHHQGLVFXVVHGLQWKHSUHFHGLQJWDEOHVRUDUHGHWDLOHGEHORZ Notable Listings: 1RQH Additional Environmental Record Sources5HTXHVWVKDYHEHHQVXEPLWWHGWRORFDOPXQLFLSDODQGVWDWHDJHQFLHVIRUSHUWLQHQWUHFRUGVSHUWDLQLQJWRWKH6XEMHFW 3URSHUW\SDUWLFXODUO\ZLWK UHJDUGWR SRWHQWLDOHQYLURQPHQWDOFRQFHUQVVXFK DV SHWUROHXPVWRUDJHWDQNVVWRUDJHDQGXVDJHRIKD]DUGRXVVXEVWDQFHVDQGSHWUROHXPSURGXFWVDQGRUNQRZQ RU VXVSHFWHG HQYLURQPHQWDO FRQWDPLQDWLRQ:KHUHDSSOLFDEOH LQWHUQHWUHVHDUFK RIJRYHUQPHQWHQYLURQPHQWDOUHJXODWRU\GDWDEDVHVZDVDOVRFRQGXFWHGDVZHOODVDJHQHUDOFXUVRU\LQWHUQHWVHDUFKRIWKH6XEMHFW3URSHUW\DGGUHVVIRULQIRUPDWLRQLQGLFDWLYHRID5(&7KHIROORZLQJ WDEOHVXPPDUL]HVWKHILQGLQJVRIWKHUHVHDUFK Source Type of Request Outcome (3$0\3URSHUW\2QOLQHVHDUFK+LOOPDQQVHDUFKHGRQOLQHIRUUHFRUGVSHUWDLQLQJWRWKH3URSHUW\1RUHFRUGVSHUWDLQLQJWRWKHSURSHUW\ZHUHIRXQG (3$(QYLURIDFWV2QOLQH VHDUFK +LOOPDQQVHDUFKHGRQOLQHIRUUHFRUGVSHUWDLQLQJWRWKH3URSHUW\1RUHFRUGV SHUWDLQLQJWRWKHSURSHUW\ZHUHIRXQG &$'76&(QYLURVWRUGDWDEDVHZZZHQYLURVWRUGWVFFDJRYSXEOLF 2QOLQHVHDUFK+LOOPDQQVHDUFKHGRQOLQHIRUUHFRUGVSHUWDLQLQJWRWKH3URSHUW\1RUHFRUGVSHUWDLQLQJWRWKHSURSHUW\ZHUHIRXQG 6RXWK&RDVW$LU4XDOLW\0DQDJHPHQW 'LVWULFW6&$40' )2,UHTXHVW$UHVSRQVHZDVUHFHLYHGVWDWLQJWKDWQRUHFRUGVZHUHIRXQG Hillmann Consulting LLC Phase I Environmental Site Assessment -21- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California Source Type of Request Outcome 5HJLRQDO:DWHU4XDOLW\&RQWURO %RDUG5:4&% )2,UHTXHVW1RUHVSRQVHZDVUHFHLYHGSULRUWRUHSRUWLVVXDQFH /RFDO)LUH3UHYHQWLRQ0DUVKDOO)2,UHTXHVW1RUHVSRQVHZDVUHFHLYHGSULRUWRUHSRUWLVVXDQFH )RQWDQD3XEOLF5HFRUGV5HTXHVW)2,UHTXHVW$UHVSRQVHZDVUHFHLYHGVWDWLQJWKDWQRUHFRUGVZHUHIRXQG &$'76&)2,UHTXHVW$UHVSRQVHZDVUHFHLYHGVWDWLQJWKDWQRUHFRUGVZHUHIRXQG ZZZUHDOTXHVWFRP2QOLQH VHDUFK +LOOPDQQVHDUFKHGRQOLQHIRUUHFRUGVSHUWDLQLQJWRWKH3URSHUW\1RUHFRUGV SHUWDLQLQJWRWKHSURSHUW\ZHUHIRXQG ,QWHUQHW6HDUFK(QJLQH2QOLQHVHDUFK+LOOPDQQVHDUFKHGRQOLQHIRUUHFRUGVSHUWDLQLQJWRWKH3URSHUW\1RUHFRUGVSHUWDLQLQJWRWKHSURSHUW\ZHUHIRXQG 3HUWLQHQWUHFRUGVUHIHUHQFHGLQWKHDERYHWDEOHKDYHEHHQLQFOXGHGLQ$SSHQGL[) 4.2 Historical Research +LVWRULFDO UHFRUGV KDYH EHHQ FRPSLOHG DQG DQDO\]HG IRUKLVWRULFDO SURSHUW\ LQIRUPDWLRQ DQGGHYHORSLQJDKLVWRU\RISUHYLRXVXVHVRIWKH6XEMHFW3URSHUW\DGMRLQLQJSURSHUWLHVDQGVXUURXQGLQJ DUHD7KHVHUHFRUGVZHUHUHYLHZHGIRUWKHSXUSRVHRILGHQWLI\LQJWKHOLNHOLKRRGRISDVWXVHVKDYLQJOHGWR5(&VLQFRQQHFWLRQZLWKWKH6XEMHFW3URSHUW\7KHKLVWRULFDOUHFRUGVRXUFHVOLVWHGEHORZKDYHEHHQVRXJKWZLWKWKHREMHFWLYHWRGRFXPHQWSDVWXVHVRIWKH6XEMHFW3URSHUW\IURPWKHSUHVHQWEDFNWRWKH6XEMHFW3URSHUW\¶VILUVWGHYHORSHGXVHRU EDFNWRZKLFKHYHULVHDUOLHU7KHWHUP³GHYHORSHGXVH´LQFOXGHVDJULFXOWXUDOXVHSODFHPHQWRIILOOGLUWDQGRWKHUXVHVWKDWGRQRWLQYROYHVWUXFWXUHV+LOOPDQQKDVVRXJKWWRUHYLHZKLVWRULFDOUHFRUGVLQPLQLPXPLQWHUYDOVRIILYH\HDUV Fire Insurance Maps $&HUWLILHG6DQERUQ0DS5HSRUWZDVREWDLQHGIURP('5IRUDUHYLHZRISXEOLVKHGKLVWRULFILUHLQVXUDQFHPDSVIRUWKH6XEMHFW3URSHUW\DQGVXUURXQGLQJDUHD7KHIROORZLQJLVDVXPPDU\RIVLWHXVHVDQGQRWDEOHGHWDLOVGHSLFWHGE\WKHDYDLODEOHPDSV Year(s) Prop/Adj Depicted Use(s) Notable Details Property: 9DFDQWODQGXQPDSSHG1RQH Adjoining: $XWRUHSDLUWRWKHQRUWKZHVWYDFDQWODQG1RQH $FRS\RIWKH&HUWLILHG6DQERUQ0DS5HSRUWLVDWWDFKHGLQ$SSHQGL[' City Directories $Q('5&LW\'LUHFWRU\$EVWUDFWUHSRUWZDVUHYLHZHGIRUGDWDRIIRUPHURFFXSDQWVRIWKH6XEMHFW3URSHUW\¶VVWUHHWDGGUHVV7KHIROORZLQJLVDJHQHUDOL]HGVXPPDU\RIWKHILQGLQJVRIFLW\GLUHFWRU\UHVHDUFKIRUSDVWRFFXSDQWVRIWKH6XEMHFW3URSHUW\ Hillmann Consulting LLC Phase I Environmental Site Assessment -22- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California Property Use(s) / Occupant(s): Years 8QLRQ6WRUH%UHPPHU(QWHUSULVH*UHDW'DQH7UDLOHUV3LQHV7UDLOHU6DOHVDQG6WRUDJH7UDLOHUV6\VWHPV 7KH('5&LW\'LUHFWRU\$EVWUDFWUHSRUWZDVDOVRUHYLHZHGIRUOLVWLQJVRIKLVWRULFRFFXSDQWVRIWKHDGMRLQLQJSURSHUWLHV7KHIROORZLQJLVDJHQHUDOVXPPDU\RIOLVWLQJVRIKLVWRULFDGMRLQLQJSURSHUW\RFFXSDQWV Adjoining Properties Use and/or Occupant(s) Years )RQWDQD7UDLOHU0DUW 7%66DOHVDQG/HDVLQJ9DOOH\%RXOHYDUG'LYHUVLILHG6DOHV6HUYLFH0DUN3RZHU7UXFN,QF5XVK7UXFNV&HQWHU)RQWDQD8VHG7UXFNV ±± )UXHKDXI7UDLOHUV2SHUDWLRQV±9DOOH\%RXOHYDUG6FKQHLGHU1DWLRQDO/RFDO*DUDJH'RRU5HSDLU ±± $FRS\RIWKH('5&LW\'LUHFWRU\UHSRUWLVDWWDFKHGLQ$SSHQGL[' Historical Topographic Maps +LVWRULFDO WRSRJUDSKLF PDSV RI WKH 3URSHUW\ DQG YLFLQLW\ REWDLQHG IURP DQ ('5 +LVWRULFDO7RSRJUDSKLF 0DS UHSRUW DV DWWDFKHG LQ $SSHQGL[ ' KDYH EHHQ UHYLHZHG 7KH IROORZLQJLQWHUSUHWDWLRQRIODQGXVDJHZDVPDGHE\UHYLHZRIWKHPDSV Year(s) Summary Property: 1RLPSURYHPHQWVDQGRUVSHFLDOGHSLFWLRQVDUHQRWHG Adjoining: 1RLPSURYHPHQWVDQGRUVSHFLDOGHSLFWLRQVDUHQRWHG Property: 8QPDSSHG Adjoining: 8QPDSSHG Property: 2QHVWUXFWXUHWRWKHQRUWK Adjoining: 0XOWLSOHVWUXFWXUHVWRWKHQRUWKHDVWQRUWKZHVWDQGZHVW Property: 6WUXFWXUHLVGHSLFWHGDWWKHQRUWKHDVWFRUQHU Adjoining: 0XOWLSOHVWUXFWXUHVWRWKHQRUWKHDVWDQGQRUWKZHVWRUFKDUGVWRWKHVRXWK Property: 7KH3URSHUW\LVKLJKOLJKWHGLQSXUSOHLQGLFDWLQJXUEDQGHYHORSPHQWVWUXFWXUHWRWKHQRUWKHDVW Adjoining: 7KHDGMRLQLQJSURSHUWLHVDUHKLJKOLJKWHGLQSXUSOHLQGLFDWLQJXUEDQGHYHORSPHQW Property: 6WUXFWXUHWRWKHQRUWKHDVW Adjoining: 3XUSOHKLJKOLJKWHGVWUXFWXUHVDUHDGMDFHQWWRWKHVRXWKHDVWDQGVRXWKZHVW LQGLFDWLQJVWUXFWXUHGHYHORSPHQW Property: 1RLPSURYHPHQWVDQGRUVSHFLDOGHSLFWLRQVDUHQRWHG Adjoining: 1RLPSURYHPHQWVDQGRUVSHFLDOGHSLFWLRQVDUHQRWHG ,IREWDLQHGFRSLHVRIKLVWRULFDOWRSRJUDSKLFPDSVKDYHEHHQLQFOXGHGLQ$SSHQGL[' Hillmann Consulting LLC Phase I Environmental Site Assessment -23- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California Historical Aerial Photographs +LVWRULFDODHULDOSKRWRJUDSKVRIWKH3URSHUW\DQGYLFLQLW\REWDLQHGIURPDQ('5$HULDO3KRWR'HFDGH3DFNDJHUHSRUWDVDWWDFKHGLQ$SSHQGL['ZHUHUHYLHZHG7KHIROORZLQJLQWHUSUHWDWLRQRIODQGXVDJHZDVPDGHE\UHYLHZRIWKHDHULDOSKRWRJUDSKV Year(s) Summary of Interpretation Property: $JULFXOWXUDOODQG Adjoining: $JULFXOWXUDOODQGZLWKDVWUXFWXUHWRWKHQRUWKQRUWKHDVWDQGQRUWKZHVW Property: $JULFXOWXUDODQGRUXQGHYHORSHGODQGZLWKDVWUXFWXUHWRWKHQRUWKHDVW Adjoining: $JULFXOWXUDODQGRU XQGHYHORSHGODQGZLWK PXOWLSOH VWUXFWXUHV WR WKHQRUWKHDVW VRXWKZHVWDQGHDVW Property: 9DFDQWORW Adjoining: $XWRWUXFNVWRUDJH\DUGWRWKHVRXWKHDVWXQGHYHORSHGODQG Property: 7KH3URSHUW\LVGHYHORSHGDVDWUDQVSRUWDWLRQWUXFNDQGRUWUDLOHUVDOHV\DUG Adjoining: 7UDQVSRUWDWLRQWUXFNDQGRUWUDLOHUVDOHV\DUGWRWKHQRUWKHDVWVRXWKDQGZHVW Property: 7KH3URSHUW\LVGHYHORSHGDVDWUDQVSRUWDWLRQWUXFNDQGRUWUDLOHUVDOHV\DUG Adjoining: 7UDQVSRUWDWLRQWUXFNDQGRUWUDLOHUVDOHV\DUGWRWKHQRUWKHDVWDQGZHVWYDFDQWORWWRWKHVRXWK ,IREWDLQHGFRSLHVRIKLVWRULFDODHULDOSKRWRJUDSKVKDYHEHHQLQFOXGHGLQ$SSHQGL[' EDR High-Risk Historical Records 7KH('55DGLXV0DSUHSRUWZKLFKLVGLVFXVVHGLQJUHDWHUGHWDLOLQ6HFWLRQDQGDWWDFKHGLQ$SSHQGL[(SURYLGHGDVHDUFKRISURSULHWDU\GDWDEDVHVRISRWHQWLDOKLVWRULFDOKLJKULVNXVHVDWRULQWKHYLFLQLW\RIWKH6XEMHFW3URSHUW\7KHVHGDWDEDVHVLQFOXGH('5+LVWRULF&OHDQHUV±DGDWDEDVH RISURSHUW\DGGUHVVHVZLWKUHFRUGVRIKLVWRULFDORFFXSDQF\E\VXVSHFWHGFOHDQHUVEXVLQHVVHV('5 +LVWRULF$XWR±DGDWDEDVHRISURSHUW\DGGUHVVHVZLWKUHFRUGVRIKLVWRULFDORFFXSDQF\E\SRWHQWLDODXWRPRWLYHJDVILOOLQJVWDWLRQVDQGUHSDLUIDFLOLWLHVDQG('50*3DGDWDEDVHRIVLWHVKLVWRULFDOO\RFFXSLHGE\PDQXIDFWXUHGJDVSODQWVDQGUHODWHGIDFLOLWLHV EDR Database On-site Listings: Adjoining/Off-Site Listings Historic Cleaners: RQVLWHDGMRLQLQJRQO\1RQH1RQH Historic Auto: RQVLWHDGMRLQLQJRQO\ 1RQH1RQH MGP: PLOHGLVWDQFH1RQH1RQH Petroleum/Natural Gas Well Review 7KHKLVWRULFDOUHFRUGVRXUFHVDQGWKH&DOLIRUQLD*HRORJLF(QHUJ\0DQDJHPHQW'LYLVLRQ&DO*(0 RQOLQHPDSSLQJDSSOLFDWLRQZHUHUHYLHZHGIRUUHFRUGVRIKLVWRULFSHWUROHXPDQGRUQDWXUDOJDVZHOOV DWWKH6XEMHFW3URSHUW\1RUHFRUGRIDQ\KLVWRULFDOSHWUROHXPQDWXUDOJDVZHOOVDWRUDGMRLQLQJWKH3URSHUW\ZDVLGHQWLILHG Hillmann Consulting LLC Phase I Environmental Site Assessment -24- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California Additional Historical Data :KHUHDSSOLFDEOHWKHIROORZLQJDGGLWLRQDOSHUWLQHQWKLVWRULFDOGDWDZDVREWDLQHG Interviews/Anecdotal: 1RDGGLWLRQDOSHUWLQHQWKLVWRULFDOGDWDZDVREWDLQHG Local Gov’t Records: 1RDGGLWLRQDOSHUWLQHQWKLVWRULFDOGDWDZDVREWDLQHG Prior Env. Reports: 6HFWLRQ1RWDSSOLFDEOHQRSULRUUHSRUWVZHUHSURYLGHG Site Observations: ,QGLFDWLRQVRIKLVWRULFXVHVRIWKH3URSHUW\RUDGMRLQLQJSURSHUWLHVZHUHQRWREVHUYHGGXULQJWKHVLWHUHFRQQDLVVDQFH Other Sources: 1RDGGLWLRQDOSHUWLQHQWKLVWRULFDOGDWDZDVREWDLQHG Summary of Identified Historic Uses 7KHIROORZLQJWDEOHSUHVHQWVDVXPPDU\RIWKHW\SHVDQGDSSUR[LPDWHGDWHUDQJHVRILGHQWLILHGSULRUXVHVRIWKH6XEMHFW3URSHUW\ Property Date Range Use 8QNWRV8QGHYHORSHGDQGRUDJULFXOWXUDOODQGWR$JULFXOWXUDOODQG WR0RVWO\UHVLGHQFHV 9DFDQWORW VWRSUHVHQW7UDQVSRUWDWLRQWUXFNDQGRUWUDLOHUVDOHV\DUG 7KHIROORZLQJWDEOHSUHVHQWVDVXPPDU\RIWKHW\SHVRILGHQWLILHGSULRUXVHVRIWKHDGMRLQLQJ SURSHUWLHV Adjoining Properties Date Range Use 8QNWRV8QGHYHORSHGDQGRUDJULFXOWXUDOODQG WR$JULFXOWXUDOODQG WR0RVWO\UHVLGHQFHVWRSUHVHQW7UDQVSRUWDWLRQWUXFNDQGRUWUDLOHUVDOHV\DUG Historical Records Data Failure 7KH$670(VWDQGDUGGHILQHVGDWDIDLOXUHDVIDLOXUHWRDFKLHYHWKHKLVWRULFDOUHVHDUFK REMHFWLYHHYHQDIWHUUHYLHZLQJWKHVWDQGDUGKLVWRULFDOVRXUFHVWKDWDUHUHDVRQDEO\DVFHUWDLQDEOHDQGOLNHO\WREHXVHIXO7KHREMHFWLYHLVWRLGHQWLI\DOOREYLRXVXVHVRIWKHSURSHUW\IURPWKHSUHVHQWEDFNWRWKHSURSHUW\¶VILUVWGHYHORSHGXVHRUEDFNWRZKLFKHYHULVHDUOLHU)XUWKHUPRUHUHFRUGVRIKLVWRULFXVHFRQGLWLRQVZHUHVRXJKWLQLQWHUYDOVQROHVVWKDQDSSUR[LPDWHO\ILYH\HDUVXQOHVVWKHSURSHUW\FRQGLWLRQVDSSHDUXQFKDQJHGRYHUDORQJHULQWHUYDO,QHQFRXQWHUHGGDWDIDLOXUH DQGLWVVLJQLILFDQFHDVDGDWDJDSLVGLVFXVVHGEHORZ Objective Met? Detail Significant? )LUVWGHYHORSHGXVHGDWHGHWHUPLQHG"1R7KH HDUOLHVW GRFXPHQWHG XVH RI WKH 3URSHUW\ ZDVDJULFXOWXUDOODQGFLUFD1R Hillmann Consulting LLC Phase I Environmental Site Assessment -25- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 5HFRUGVRXUFHVDW\HDULQWHUYDOVEDFNWRRUILUVWGHYHORSHGXVH" <HV+LVWRULFDO UHFRUG JDSV H[FHHGLQJ ILYH \HDUV ZHUHHQFRXQWHUHG+RZHYHUVLJQLILFDQWVLWHXVHFKDQJHVRUXQGLVFRYHUHGVLWHXVHVDSSHDUXQOLNHO\WRKDYHRFFXUUHGGXULQJWKHUHFRUGJDSV 1R $OOREYLRXVSULRUXVHVLGHQWLILHG"<HV6HH6XPPDU\RI,GHQWLILHG3DVW8VHVRIWKLVVHFWLRQ1$ 3OHDVHUHIHUWR6HFWLRQIRUDGGLWLRQDOGLVFXVVLRQRIGDWDJDSVDQGWKHLUVLJQLILFDQFHWRWKH ILQGLQJVRIWKHDVVHVVPHQW Historic Uses REC Discussion 7KHUHYLHZRIKLVWRULFDOUHFRUGVGLGQRWLQGLFDWHHYLGHQFHRID5(&LQFRQQHFWLRQZLWKWKH3URSHUW\ 7KH 3URSHUW\ ZDV KLVWRULFDOO\ XWLOL]HG IRU DJULFXOWXUDO SXUSRVHV *LYHQ WKHVXEVHTXHQW VLWHUHGHYHORSPHQWWKHSRWHQWLDOIRUFRQFHQWUDWHGSHVWLFLGHVLQVKDOORZVRLOVLVFRQVLGHUHGWREHORZDQGWKHUHIRUHKLVWRULFDODJULFXOWXUDOXVHLVQRWFRQVLGHUHGD5(& 7KH3URSHUW\ZDVGHYHORSHGLQWRLWVFXUUHQWFRQILJXUDWLRQDVDWUDQVSRUWDWLRQWUXFNDQGRUWUDLOHU VDOHV\DUGVLQFHDSSUR[LPDWHO\WKHVWRSUHVHQW7KHIXWXUHLQWHQGHGXVDJHRIWKH3URSHUW\ZLOOEHDFRPPHUFLDOZDUHKRXVHEXLOGLQJ7KHDGMRLQLQJSURSHUWLHVDSSHDUWRKDYHEHHQGHYHORSHGDVDFDUWUXFNDQGWUDLOHUVDOHVFHQWHU VLQFHDSSUR[LPDWHO\WKHODWHVWRSUHVHQW Hillmann Consulting LLC Phase I Environmental Site Assessment -26- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 5.0 INTERVIEWS 5.1 Interviews with Owners, Operators and Occupants Current Owner Property Owner Contact Name Affiliation Interview Type 5LYHUVLGH)RQWDQD-LP3LQHV2ZQHU(PDLOTXHVWLRQQDLUH Interview Date: Interview Outcome/Findings: $QHQYLURQPHQWDOTXHVWLRQQDLUHIRULQIRUPDWLRQSHUWLQHQWWRWKHDVVHVVPHQWZDVIRUZDUGHGWRSURSHUW\RZQHUVKLS+RZHYHUDFRPSOHWHGTXHVWLRQQDLUHZDVQHYHUUHFHLYHG Key Site Manager/Operator Name Company/Title Yrs @ Site Interview Type 0DU6DPD\RD6RXWKHUQ&DOLIRUQLD*UHDW'DQH0DQDJHU,QSHUVRQ Interview Date: )HEUXDU\ Interview Outcome/Findings: $QLQWHUYLHZZDVFRQGXFWHGLQSHUVRQDWWKHWLPHRIWKHVLWHYLVLW3HUWLQHQWLQIRUPDWLRQZKHUHDSSOLFDEOHLVUHIHUHQFHGLQWKHDSSURSULDWHVHFWLRQVRIWKLVUHSRUW Occupant(s) Name Company/Title Yrs @ Site Interview Type 0DU6DPD\RD6RXWKHUQ&DOLIRUQLD*UHDW'DQH0DQDJHU,QSHUVRQ Interview Date: )HEUXDU\ Interview Outcome/Findings: $QLQWHUYLHZZDVFRQGXFWHGLQSHUVRQDWWKHWLPHRIWKHVLWHYLVLW3HUWLQHQWLQIRUPDWLRQZKHUHDSSOLFDEOHLVUHIHUHQFHGLQWKHDSSURSULDWHVHFWLRQVRIWKLVUHSRUW Prior Owners/Operators/Occupants Name Company/Title Yrs @ Site Interview Type -RHO%LVKRS*UHDW'DQH3KRQH Interview Date: )HEUXDU\ Interview Outcome/Findings: Hillmann Consulting LLC Phase I Environmental Site Assessment -27- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California $QLQWHUYLHZZDVFRQGXFWHGYLDSKRQH3HUWLQHQWLQIRUPDWLRQZKHUHDSSOLFDEOHLVUHIHUHQFHGLQWKHDSSURSULDWHVHFWLRQVRIWKLVUHSRUW Neighboring Property Owner/Occupants Name Company/Title Yrs at site Interview Type 1$ Interview Date: Interview Outcome/Findings: 7KH3URSHUW\ZDVQRWDQDEDQGRQHGSURSHUW\ZLWKHYLGHQFHRIXQDXWKRUL]HGXVHVRUXQFRQWUROOHGDFFHVVWKHUHIRUHLQWHUYLHZVZLWKDGMRLQLQJRUQHDUE\SURSHUW\RZQHUVRURFFXSDQWVZHUHQRWFRQGXFWHG 5.2 Interviews with State and/or Local Government Officials 6WDWHDQGRUORFDOJRYHUQPHQWDORIILFLDOVKDYHEHHQLQWHUYLHZHGWRREWDLQLQIRUPDWLRQRISRWHQWLDO5(&VLQFRQQHFWLRQZLWKWKH6XEMHFW3URSHUW\0DQ\JRYHUQPHQWDJHQFLHVDQGWKHLURIILFLDOVUHTXLUHVXEPLWWDORIZULWWHQUHTXHVWIRUUHFRUGVLQRUGHUWRUHVSRQG7KHGHWDLOVLQ6HFWLRQOLVWWKHYDULRXVVWDWHDQGORFDOJRYHUQPHQWDJHQFLHVFRQWDFWHGDVSDUWRIWKLVDVVHVVPHQWDQGWKH RXWFRPHRIHDFKLQTXLU\,QDGGLWLRQWKHGHWDLOVRIUHJXODWRU\GDWDEDVHUHVHDUFKLQ6HFWLRQPD\ KDYH LQFOXGHG GHWDLO RI LQWHUYLHZV ZLWKRIILFLDOVSHUWLQHQW WR JRYHUQPHQW UHFRUGV UHYLHZ DQGLGHQWLILFDWLRQRI5(&V$GGLWLRQDOLQWHUYLHZRIJRYHUQPHQWRIILFLDOVQRWSUHYLRXVO\GHWDLOHGLQ6HFWLRQVDUHGLVFXVVHG EHORZLIDSSOLFDEOH Name Agency Name/Title Interview Type 1$ Interview Outcome/Findings: 1RDGGLWLRQDOORFDOVWDWHJRYHUQPHQWRIILFLDOVZHUHLQWHUYLHZHG Hillmann Consulting LLC Phase I Environmental Site Assessment -28- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 6.0 SITE RECONNAISSANCE 6.1 Methodology and Limiting Conditions $VLWHUHFRQQDLVVDQFHZDVFRQGXFWHGWRFROOHFWLQIRUPDWLRQDQGPDNHREVHUYDWLRQVWRKHOSLGHQWLI\5(&VLQFRQQHFWLRQZLWKWKH6XEMHFW3URSHUW\7KLVLQFOXGHGYLVXDODQGRUSK\VLFDOREVHUYDWLRQVRIWKH6XEMHFW3URSHUW\DQGLWVVWUXFWXUHVDGMRLQLQJSURSHUWLHVDVYLHZHGIURPWKH6XEMHFW3URSHUW\ERXQGDULHV DQG WKH VXUURXQGLQJ DUHD EDVHG RQ YLVXDO REVHUYDWLRQV IURPDGMRLQLQJSXEOLF WKRURXJKIDUHVDQGDFFHVVHG6XEMHFW3URSHUW\VWUXFWXUHV6XEMHFWSURSHUW\EXLOGLQJH[WHULRUVZHUH REVHUYHGDWJURXQGOHYHOXQOHVVRWKHUZLVHLQGLFDWHG:KHUHDSSOLFDEOHEXLOGLQJLQWHULRUVZHUHDFFHVVHGDQGREVHUYHGWRWKHH[WHQWWKH\ZHUHPDGHVDIHO\DFFHVVLEOHZLWKWKHFRRSHUDWLRQRIWKHVLWHHVFRUW Site Inspection Personnel: 0V6KLOSD6XQLO Property Escort/Company: 0U0DU6DPD\RD6DOHV0DQDJHU Inspection Date: )HEUXDU\ Weather Conditions: 6XQQ\GHJUHHV) Significant Inaccessible Areas 1RVLJQLILFDQWDUHDVRIWKH3URSHUW\LQDFFHVVLEOHDWWKHWLPHRIWKHLQVSHFWLRQZHUHQRWHG Significant Limiting Site Conditions1RVLJQLILFDQWOLPLWLQJVLWHFRQGLWLRQVZHUHQRWHGDWWKHWLPHRIWKHVLWHUHFRQQDLVVDQFH 6.2 General Site Setting Site and Vicinity Characteristics Abutting Roadways: 9DOOH\%RXOHYDUGWRWKHQRUWK Current Property Use: *UHDW'DQH7UDLOHUV6RXWKHUQ&$ Evidence of Past Property Uses: 1RQHREVHUYHG Evidence of Past Adjoining Property Uses: 1RQHREVHUYHG Surrounding Area Uses: &RPPHUFLDODQGOLJKWLQGXVWULDO Hillmann Consulting LLC Phase I Environmental Site Assessment -29- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California Current Adjoining Property Uses Dir Street Address Description N 9DOOH\%RXOHYDUG6ZLIW'HGLFDWHG7HDP E &KHUU\$YHQXH7UDQV:HVW7UXFN&HQWHU S 1$9DFDQWORW NW 9DOOH\%RXOHYDUG5XVK7UXFN&HQWHUV)RQWDQD8VHG7UXFNV 1RYLVXDOREVHUYDWLRQVLQGLFDWLYHRIDSRWHQWLDOHQYLURQPHQWDOFRQFHUQZHUHQRWHGRQWKHDGMRLQLQJ SURSHUWLHV Topographic Characteristics Terrain: )ODWWRJHQWO\VORSLQJ Direction of Downward Slope: 7RZDUGVWKHVRXWKVRXWKZHVW On-site Water Bodies: 1RQHREVHUYHG Other Significant Features: 1RQHREVHUYHG General Description of Structures and Improvements Buildings: 2QH±RIILFHWUDLOHU Approx. Building Size: Approx. Year Built: Number of Stories: Basement/Subgrade Levels: 1$ Exterior Ground Cover: $VSKDOWSDUNLQJORWJUDVVODZQODQGVFDSLQJ Ancillary Structures: Sources of Heating & Cooling: 1DWXUDOJDVDQGHOHFWULFSRZHUHGV\VWHPV Potable Water/Sewage Disposal: 0XQLFLSDOXWLOLW\FRQQHFWLRQV 6.3 Site Features and Conditions Storage/Usage of Hazardous Substances and Petroleum Products 7KH IROORZLQJDSSUR[LPDWH QXPEHU RI FRQWDLQHUVDQG JHQHUDO GHVFULSWLRQ RI WKHLU FRQWHQWV FDSDFLW\FRQWDLQHUW\SHVDQGVWRUDJHFRQGLWLRQVZHUHREVHUYHGWREHVWRUHGDQGRUXVHGDWWKH 6XEMHFW3URSHUW\ Hillmann Consulting LLC Phase I Environmental Site Assessment -30- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California Occupant Substance Qty/Container Type Storage Conditions *UHDW'DQH'HJUHDVHUJDVROLQHHPSW\JDOORQFRQWDLQHU,QWHULRURIFRQWDLQHUJRRG Bulk Petroleum/Hazardous Material Storage Tanks 7KHIROORZLQJVWRUDJHWDQNVIRUEXONSHWUROHXPRUKD]DUGRXVPDWHULDOVWRUDJHZHUHLGHQWLILHGRUUHSRUWHGWREHSUHVHQWRUDUHVXVSHFWHGWREHSUHVHQWEDVHGRQYLVXDOREVHUYDWLRQV AST/ UST Product Capacity Construction Year Installed Status Location/Notes $67:DWHU±XVHGIRUZDVKLQJWUDLOHUVJDOORQ3ODVWLF8QNQRZQ*RRG,QWHULRURIFRQWDLQHUJRRG :KLOHQRYLVXDOHYLGHQFHRID867ZDVQRWHGFRQVLGHULQJWKHKLVWRU\RIGHYHORSPHQWWKHSRWHQWLDOSUHVHQFHRIDEDQGRQHG867VDQGRUDVVRFLDWHGEXULHGSLSLQJDWWKH6XEMHFW3URSHUW\FDQQRWEHUXOHGRXW Strong, Pungent or Noxious Odors and their Sources 1RVWURQJSXQJHQWRUQR[LRXVRGRUVZHUHQRWHGDWWKH6XEMHFW3URSHUW\ Standing Surface Water/Pools & Sumps 1R VWDQGLQJ ZDWHU SRROV RU VXPSV FRQWDLQLQJ OLTXLGV OLNHO\ WR EH KD]DUGRXV VXEVWDQFHV RUSHWUROHXPSURGXFWVZHUHQRWHG Drums, Totes and Intermediate Bulk Containers 1RKD]DUGRXVVXEVWDQFHRUSHWUROHXPSURGXFWGUXPVZHUHQRWHG Unidentified Substance Containers 1RXQLGHQWLILHGVXEVWDQFHFRQWDLQHUVVXVSHFWHGRIFRQWDLQLQJKD]DUGRXVVXEVWDQFHRUSHWUROHXP SURGXFWZHUHQRWHG PCBs in Oil Filled Electrical/Hydraulic Equipment 3&%VLQHOHFWULFDOK\GUDXOLFHTXLSPHQWDUHFRQVLGHUHGXQOLNHO\DWWKH6XEMHFW3URSHUW\EDVHGRQ WKHSRVWGDWHRIWKHFXUUHQWVLWHGHYHORSPHQW,WLVQRWHGWKDWLGHQWLILFDWLRQRI3&%FRQWDLQLQJIOXRUHVFHQWOLJKWEDOODVWVFDXONSDLQWRURWKHUPDWHULDOVORFDWHGLQVLGHDQGDUHSDUWRIWKHEXLOGLQJRUVWUXFWXUHLVRXWVLGHRIWKHVFRSHRIWKH$670(VWDQGDUGDQGWKLVDVVHVVPHQW Stains or Corrosion on Floors, Walls or Ceilings 1REXLOGLQJVWUXFWXUHVZHUHSUHVHQWDWWKH3URSHUW\ Hillmann Consulting LLC Phase I Environmental Site Assessment -31- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California Drains and Sumps 1RIORRUGUDLQVRUVXPSVZHUHQRWHGDWWKH6XEMHFW3URSHUW\ Pits/Ponds/Lagoons 1RSLWVSRQGVRUODJRRQVZHUHLGHQWLILHGLQFRQQHFWLRQZLWKZDVWHWUHDWPHQWRUGLVSRVDO Stained Soil, Pavement/Stressed Vegetation 7KHIROORZLQJVWDLQHGVRLOSDYHPHQWDQGRUVWUHVVHGYHJHWDWLRQZDVREVHUYHG+LOOPDQQREVHUYHG de minimisRLOVWDLQLQJRQWKHVRXWKHUQSURSRUWLRQRIWKH3URSHUW\7KHVWDLQLQJLVQRWFRQVLGHUHGWREHD5(&WRWKH3URSHUW\ On-Site Solid Waste Disposal/Fill Material 1RHYLGHQFHRIRQVLWHGLVSRVDORIWUDVKFRQVWUXFWLRQGHEULVGHPROLWLRQGHEULVRURWKHUVROLGZDVWHZDVREVHUYHG Waste Water 6DQLWDU\VHZDJHJHQHUDWHGDWWKH6XEMHFW3URSHUW\LVGLVFKDUJHGYLDDFRQQHFWLRQWRWKHORFDOSXEOLFVHZHUV\VWHP1RDGGLWLRQDOZDVWHZDWHUGLVFKDUJHVZHUHLGHQWLILHGDWWKH6XEMHFW3URSHUW\ Septic Systems/Cesspools 1RVHSWLFV\VWHPVRUFHVVSRROVZHUHLGHQWLILHGDWWKH6XEMHFW3URSHUW\ Wells1RZHOOVLQFOXGLQJDQ\GU\ZHOOVLUULJDWLRQZHOOVLQMHFWLRQZHOOVDEDQGRQHGZHOOVRURWKHUZHOOVZHUHLGHQWLILHGDWWKH6XEMHFW3URSHUW\ Railroad Spurs1RUDLOURDGVSXUVZHUHLGHQWLILHGRQWKH6XEMHFW3URSHUW\ Hillmann Consulting LLC Phase I Environmental Site Assessment -32- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 7.0 BUSINESS ENVIRONMENTAL RISKS ,QDFFRUGDQFHZLWKWKHFRQWUDFWDJUHHPHQWIRUWKLVDVVHVVPHQW+LOOPDQQKDVSHUIRUPHGFXUVRU\UHYLHZV RI VHYHUDO SRWHQWLDO%XVLQHVV (QYLURQPHQWDO 5LVNV DOVR NQRZQ DV ³1RQ6FRSH&RQVLGHUDWLRQV´7KH$670(VWDQGDUGGHILQHVWKHWHUPEXVLQHVVHQYLURQPHQWDOULVN%(5DV“a risk which can have a material environmental or environmentally-driven impact on the business associated with the current or planned use of a parcel of commercial real estate, not necessarily limited to those environmental issues required to be investigated in this practice.” 7.1 Asbestos-Containing Material (ACM) 7KH FRQWUDFWHGVFRSHRIZRUNLQFOXGHG D FXUVRU\YLVXDOVFUHHQLQJRIWKH DFFHVVHG SRUWLRQVRIEXLOGLQJVDWWKH6XEMHFW3URSHUW\EXLOWSULRUWRIRUVXVSHFWDVEHVWRVFRQWDLQLQJPDWHULDOV$&0 7KHLQIRUPDWLRQSURYLGHGLQWKLVVHFWLRQZKHUHDSSOLFDEOHLVOLPLWHGWRLGHQWLILFDWLRQRISRWHQWLDO VXVSHFWPDWHULDOVLQWKHUHDGLO\DFFHVVLEOHDQGREVHUYHGDUHDVRIWKHEXLOGLQJDQGWKHLUJHQHUDOFRQGLWLRQ7KLVLVQRWLQWHQGHGWREHDFRPSUHKHQVLYHVXUYH\IRUWKHSUHVHQFHRI$&0DQGQRWHVWLQJKDVEHHQFRQGXFWHG 1REXLOGLQJVZHUHSUHVHQWDWWKH3URSHUW\ 7.2 Lead-Based Paint 7KHFRQWUDFWHGVFRSHRIZRUNLQFOXGHGDFXUVRU\YLVXDOVFUHHQLQJRIWKHFRQGLWLRQRISDLQWHGVXUIDFHVLQWKHDFFHVVHGDUHDVRIUHVLGHQWLDOEXLOGLQJVXQLWVEXLOWSULRUWR7KLVLVQRWLQWHQGHGWRFRQVWLWXWHDFRPSUHKHQVLYHVXUYH\IRU/%3RUSRWHQWLDOOHDGKD]DUGVDQGQRWHVWLQJKDVEHHQ FRQGXFWHG1RUHVLGHQWLDOEXLOGLQJVZHUHSUHVHQWDWWKH3URSHUW\ 7.3 Radon 'DWDFRPSLOHGE\WKH86(3$DVVXPPDUL]HGE\WKHUHJXODWRU\GDWDEDVHUHSRUWLQGLFDWHGWKDWWKH 6XEMHFW3URSHUW\LVORFDWHGLQDQDUHDFODVVLILHGDV=RQHRU PRGHUDWHULVN DUHDIRUUDGRQ5DGRQWHVWLQJZDVQRWLQFOXGHGLQWKHVFRSHRIWKLVDVVHVVPHQW 7.4 Mold/Microbial Damage 7KHFRQWUDFWHGVFRSHRIZRUNLQFOXGHGDFXUVRU\YLVXDOVFUHHQLQJRIWKHDFFHVVHGDUHDVRIWKH EXLOGLQJIRUHYLGHQFHRIVLJQLILFDQWGDPDJHWREXLOGLQJPDWHULDOVDQGILQLVKHVDVUHVXOWRIPRLVWXUHLQWUXVLRQ DQGRUPROGPLFURELDO JURZWK+LOOPDQQ GLG QRW REVHUYH HYLGHQFH RI VLJQLILFDQWSUREOHPVZLWKPRLVWXUHLQWUXVLRQRUPROGPLFURELDOJURZWKDWWKH3URSHUW\ 7.5 NWI Mapped Wetlands 7KH 1DWLRQDO :HWODQGV ,QYHQWRU\ RQOLQH :HWODQG 0DSSHU KWWSVZZZIZVJRYZHWODQGV GDWDPDSSHUKWPOZDV UHYLHZHG IRU LQGLFDWLRQV RI MXULVGLFWLRQDO ZHWODQGV DW RU LPPHGLDWHO\ Hillmann Consulting LLC Phase I Environmental Site Assessment -33- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California DGMRLQLQJ WKH 6XEMHFW 3URSHUW\ 7KH VFRSH RI ZRUN IRU WKLV DVVHVVPHQW H[FOXGHG D YLVXDOGHWHUPLQDWLRQRIUHJXODWHGZHWODQGVDWWKH6XEMHFW3URSHUW\,WLVHPSKDVL]HGWKDWUHJDUGOHVVRIWKHGDWDUHYLHZHGYLDWKH1:,:HWODQGV0DSSHUDILHOGGHOLQHDWLRQRIUHJXODWHGZHWODQGVE\DTXDOLILHGSURIHVVLRQDO ZRXOG EHZDUUDQWHGWR GHWHUPLQHWKHSUHVHQFHRUDEVHQFHRIUHJXODWHGZHWODQGVDWWKH6XEMHFW3URSHUW\ 7KHUHYLHZGLGQRWLQGLFDWHUHJXODWHGZHWODQGDUHDVRQWKH3URSHUW\ 7.6 Lead in Drinking Water 7KHVFRSHRIZRUNIRUWKLVDVVHVVPHQWLQFOXGHGDUHYLHZRIWKHSRWHQWLDOIRUHOHYDWHGOHYHOVRIOHDGLQGULQNLQJZDWHUE\GHWHUPLQLQJWKHVRXUFHRIWKHGULQNLQJZDWHUVXSSO\DQGDUHYLHZRIDYDLODEOH FRPSOLDQFHRUWHVWLQJGDWD3RWDEOHZDWHUVHUYLFHDWWKH3URSHUW\LVSURYLGHGE\DXWLOLW\FRQQHFWLRQZLWKWKH)RQWDQD:DWHU&RPSDQ\$UHFHQWO\SXEOLVKHGZDWHUTXDOLW\UHSRUWIURPWKHXWLOLW\LQGLFDWHGFRPSOLDQFHZLWK86(3$ZDWHUTXDOLW\VWDQGDUGVIRUOHDGLQGULQNLQJZDWHU$FRS\RIWKHUHSRUWKDVEHHQDWWDFKHG LQ$SSHQGL[) Hillmann Consulting LLC Phase I Environmental Site Assessment -34- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 8.0 REFERENCES $670(6WDQGDUG3UDFWLFHIRU(QYLURQPHQWDO6LWH$VVHVVPHQWV3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW3URFHVV$670,QWHUQDWLRQDO$670(6WDQGDUG*XLGHIRU9DSRU(QFURDFKPHQW6FUHHQLQJRQ3URSHUW\,QYROYHGLQ5HDO(VWDWH7UDQVDFWLRQ$670,QWHUQDWLRQDO ('55DGLXV0DS5HSRUWDQGKLVWRULFDOUHFRUGUHSRUWVGLVFXVVHGLQ6HFWLRQ(QYLURQPHQWDO'DWD5HVRXUFHV0HWKRGRORJ\IRU,GHQWLI\LQJWKH$UHDRI&RQFHUQ$URXQGD3URSHUW\3RWHQWLDOO\,PSDFWHGE\9DSRU 0LJUDWLRQIURP1HDUE\&RQWDPLQDWHG6RXUFHV$%XRQLFRUH Hillmann Consulting LLC Phase I Environmental Site Assessment -35- Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California 9.0 APPENDICES $SSHQGL[$6LWH'LDJUDP9LFLQLW\0DS$SSHQGL[%6LWH3KRWRJUDSKV$SSHQGL[&4XHVWLRQQDLUHV8VHU3URYLGHG,QIRUPDWLRQ$SSHQGL['+LVWRULFDO5HFRUGV'RFXPHQWDWLRQ$SSHQGL[(5HJXODWRU\5HFRUGV'RFXPHQWDWLRQ $SSHQGL[)2WKHU'RFXPHQWV/DE5HVXOWV$SSHQGL[*3URMHFW3HUVRQQHO4XDOLILFDWLRQV Hillmann Consulting LLC Phase I Environmental Site Assessment Hillmann Project No. C3-8909 14387 Valley Boulevard, Fontana, California APPENDIX A MAPS / DIAGRAMS Figure 1: Site Vicinity Map N 14387 Valley Boulevard Fontana, California SCALE: (NOT TO SCALE) PROJECT No.: C3-8909 6LWH Figure 2: Site Diagram N 14387 Valley Boulevard Fontana, California SCALE: (NOT TO SCALE) PROJECT No.: C3-8909 6LWH De minimisVWDLQLQJREVHUYHG Hillmann Consulting LLC Phase I Environmental Site Assessment Hillmann Project No.: C3-8909 14387 Valley Boulevard, Fontana, California APPENDIX B SITE PHOTOGRAPHS Site Photographs - Page 1 SITE PHOTOGRAPHS View of the Subject Property facing southeast View of the office trailer to the northeast portion of the Subject Property View of Subject Property facing south View of the trailer containers used for storage Interior view of storage container View of 250-gallon above ground storage tank used for water and 5-gallon container degreaser PHASE I ESA - SITE PHOTOGRAPHS 14387 Valley Boulevard, Fontana, California Project No.: C3-8909 Site Photographs - Page 2 SITE PHOTOGRAPHS View of 5-gallon empty gasoline containers stored inside the trailer Additional view of the Subject Property facing west View of de minimis oil staining on southside of the Subject Property View of container trailer used for storage of break cleaners and aerosols View of tire storage area View of 5-gallon container of waste PHASE I ESA - SITE PHOTOGRAPHS 14387 Valley Boulevard, Fontana, California Project No.: C3-8909 Site Photographs - Page 3 SITE PHOTOGRAPHS View of concrete pad used for break Interior view of container used for storage of break cleaners and aerosols View of empty totes and air compressor View of water line Interior view of office trailer View of south adjoining property PHASE I ESA - SITE PHOTOGRAPHS 14387 Valley Boulevard, Fontana, California Project No.: C3-8909 Site Photographs - Page 4 SITE PHOTOGRAPHS View of property to the north across Valley Boulevard View of adjoining property to the west PHASE I ESA - SITE PHOTOGRAPHS 14387 Valley Boulevard, Fontana, California Project No.: C3-8909 Hillmann Consulting LLC Phase I Environmental Site Assessment Hillmann Project No.: C3-8909 14387 Valley Boulevard, Fontana, California APPENDIX C QUESTIONNAIRES/USER PROVIDED DOCUMENTATION Hillmann Consulting LLC Phase I Environmental Site Assessment Hillmann Project No.: C3-8909 14387 Valley Boulevard, Fontana, California APPENDIX D HISTORICAL RECORDS DOCUMENTATION The EDR Aerial Photo Decade Package 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Inquiry Number: February 11, 2022 6852412.8 6 Armstrong Road, 4th floor Shelton, CT 06484 Toll Free: 800.352.0050 www.edrnet.com 2016 1"=500'Flight Year: 2016 USDA/NAIP 2012 1"=500'Flight Year: 2012 USDA/NAIP 2009 1"=500'Flight Year: 2009 USDA/NAIP 2006 1"=500'Flight Year: 2006 USDA/NAIP 1990 1"=500'Flight Date: September 06, 1990 USDA 1985 1"=500'Flight Date: September 13, 1985 USDA 1977 1"=500'Flight Date: January 01, 1977 Teledyne 1967 1"=500'Flight Date: May 15, 1967 USDA 1959 1"=500'Flight Date: October 15, 1959 USDA 1953 1"=500'Flight Date: January 31, 1953 USDA 1948 1"=500'Flight Date: July 10, 1948 USGS 1938 1"=500'Flight Date: May 27, 1938 USDA EDR Aerial Photo Decade Package 02/11/22 14387 Valley Boulevard Site Name:Client Name: Hillmann Environmental Co. 14387 Valley Boulevard 1745 W Orangewood Avenue Fontana, CA 92335 Orange, CA 92868-0000 EDR Inquiry #6852412.8 Contact:Shilpa Sunil Environmental Data Resources, Inc. (EDR) Aerial Photo Decade Package is a screening tool designed to assist environmental professionals in evaluating potential liability on a target property resulting from past activities. EDR’s professional researchers provide digitally reproduced historical aerial photographs, and when available, provide one photo per decade. Search Results: Year Scale Details Source When delivered electronically by EDR, the aerial photo images included with this report are for ONE TIME USE ONLY. Further reproduction of these aerial photo images is prohibited without permission from EDR. For more information contact your EDR Account Executive. Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2022 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission. EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. 6852412 8-page 2 6852412.8 2016 = 500' 6852412.8 2012 = 500' 6852412.8 2009 = 500' 6852412.8 2006 = 500' 6852412.8 1990 = 500' 6852412.8 1985 = 500' 6852412.8 1977 = 500' 6852412.8 1967 = 500' 6852412.8 1959 = 500' 6852412.8 1953 = 500' 6852412.8 1948 = 500' 6852412.8 1938 = 500' EDR Historical Topo Map Report Inquiry Number: 6 Armstrong Road, 4th floor Shelton, CT 06484 Toll Free: 800.352.0050 www.edrnet.com with QuadMatch™ 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 February 09, 2022 6852412.4 EDR Historical Topo Map Report EDR Inquiry # Search Results: P.O.# Project: Maps Provided: Disclaimer - Copyright and Trademark Notice EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. page- Coordinates: Latitude: Longitude: UTM Zone: UTM X Meters: UTM Y Meters: Elevation: Contact: Site Name: Client Name: 2018 2015 2012 1980, 1981 1975, 1976 1973 1966, 1967 1954 1953 1943 1942, 1944 1941 1903 1901 1898, 1900 1896, 1897 02/09/22 14387 Valley Boulevard Hillmann Environmental Co. 14387 Valley Boulevard 1745 W Orangewood Avenue Fontana, CA 92335 Orange, CA 92868-0000 6852412.4 Shilpa Sunil EDR Topographic Map Library has been searched by EDR and maps covering the target property location as provided by Hillmann Environmental Co. were identified for the years listed below. EDR’s Historical Topo Map Report is designed to assist professionals in evaluating potential liability on a target property resulting from past activities. EDRs Historical Topo Map Report includes a search of a collection of public and private color historical topographic maps, dating back to the late 1800s. NA 34.069167 34° 4' 9" North C3-8909 -117.491547 -117° 29' 30" West Zone 11 North 454643.32 3769934.11 1035.00' above sea level This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2022 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission. 6852412 4 2 page Topo Sheet Key This EDR Topo Map Report is based upon the following USGS topographic map sheets. - 2018 Source Sheets 2018 Fontana 7.5-minute, 24000 2018 Guasti 7.5-minute, 24000 2015 Source Sheets 2015 Fontana 7.5-minute, 24000 2015 Guasti 7.5-minute, 24000 2012 Source Sheets 2012 Fontana 7.5-minute, 24000 2012 Guasti 7.5-minute, 24000 1980, 1981 Source Sheets 1980 Fontana 7.5-minute, 24000 Aerial Photo Revised 1978 1981 Guasti 7.5-minute, 24000 Aerial Photo Revised 1978 6852412 4 3 page Topo Sheet Key This EDR Topo Map Report is based upon the following USGS topographic map sheets. - 1975, 1976 Source Sheets 1975 SAN BERNARDINO 15-minute, 50000 1976 ONTARIO 15-minute, 50000 1973 Source Sheets 1973 Fontana 7.5-minute, 24000 Aerial Photo Revised 1973 1973 Guasti 7.5-minute, 24000 Aerial Photo Revised 1973 1966, 1967 Source Sheets 1966 Guasti 7.5-minute, 24000 Aerial Photo Revised 1966 1967 Fontana 7.5-minute, 24000 Aerial Photo Revised 1966 1954 Source Sheets 1954 Ontario 15-minute, 62500 Aerial Photo Revised 1952 1954 San Bernardino 15-minute, 62500 Aerial Photo Revised 1952 6852412 4 4 page Topo Sheet Key This EDR Topo Map Report is based upon the following USGS topographic map sheets. - 1953 Source Sheets 1953 Fontana 7.5-minute, 24000 Aerial Photo Revised 1952 1953 Guasti 7.5-minute, 24000 Aerial Photo Revised 1952 1943 Source Sheets 1943 Fontana 7.5-minute, 31680 1942, 1944 Source Sheets 1942 SAN BERNARDINO 15-minute, 50000 1944 CUCAMONGA 15-minute, 50000 1941 Source Sheets 1941 GUASTI VICINITY 7.5-minute, 31680 6852412 4 5 page Topo Sheet Key This EDR Topo Map Report is based upon the following USGS topographic map sheets. - 1903 Source Sheets 1903 Cucamonga 15-minute, 62500 1901 Source Sheets 1901 San Bernardino 15-minute, 62500 1898, 1900 Source Sheets 1898 San Bernardino 15-minute, 62500 1900 Cucamonga 15-minute, 62500 1896, 1897 Source Sheets 1896 San Bernardino 15-minute, 62500 1897 Cucamonga 15-minute, 62500 6852412 4 6 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 2018 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, Fontana, 2018, 7.5-minute W, Guasti, 2018, 7.5-minute 6852412 4 7 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 2015 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, Fontana, 2015, 7.5-minute W, Guasti, 2015, 7.5-minute 6852412 4 8 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 2012 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, Fontana, 2012, 7.5-minute W, Guasti, 2012, 7.5-minute 6852412 4 9 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1980, 1981 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, Fontana, 1980, 7.5-minute W, Guasti, 1981, 7.5-minute 6852412 4 10 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1975, 1976 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, SAN BERNARDINO, 1975, 15-minute NW, ONTARIO, 1976, 15-minute 6852412 4 11 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1973 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, Fontana, 1973, 7.5-minute W, Guasti, 1973, 7.5-minute 6852412 4 12 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1966, 1967 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, Fontana, 1967, 7.5-minute W, Guasti, 1966, 7.5-minute 6852412 4 13 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1954 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, San Bernardino, 1954, 15-minute NW, Ontario, 1954, 15-minute 6852412 4 14 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1953 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, Fontana, 1953, 7.5-minute W, Guasti, 1953, 7.5-minute 6852412 4 15 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1943 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, Fontana, 1943, 7.5-minute 6852412 4 16 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1942, 1944 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, SAN BERNARDINO, 1942, 15-minute NW, CUCAMONGA, 1944, 15-minute 6852412 4 17 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1941 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. NW, GUASTI VICINITY, 1941, 7.5-minute 6852412 4 18 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1903 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. NW, Cucamonga, 1903, 15-minute 6852412 4 19 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1901 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, San Bernardino, 1901, 15-minute 6852412 4 20 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1898, 1900 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, San Bernardino, 1898, 15-minute NW, Cucamonga, 1900, 15-minute 6852412 4 21 Historical Topo Map page SITE NAME: ADDRESS: CLIENT: This report includes information from the following map sheet(s). - EW SW S SE NW N NE 1896, 1897 0 Miles 0.25 0.5 1 1.5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Hillmann Environmental Co. TP, San Bernardino, 1896, 15-minute NW, Cucamonga, 1897, 15-minute 6852412 4 22 Certified Sanborn® Map Report Inquiry Number: 6 Armstrong Road, 4th floor Shelton, CT 06484 Toll Free: 800.352.0050 www.edrnet.com 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 February 09, 2022 6852412.3 Certified Sanborn® Map Report Certified Sanborn Results: Disclaimer - Copyright and Trademark Notice EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. page- The Sanborn Library includes more than 1.2 million fire insurance maps from Sanborn, Bromley, Perris & Browne, Hopkins, Barlow and others which track historical property usage in approximately 12,000 American cities and towns. Collections searched: Library of Congress University Publications of America EDR Private Collection The Sanborn Library LLC Since 1866™ Limited Permission To Make Copies Sanborn® Library search results Contact:EDR Inquiry # Site Name: Client Name: Certification # PO # Project 1938 1929 02/09/22 14387 Valley Boulevard 14387 Valley Boulevard Hillmann Environmental Co. 1745 W Orangewood Avenue Fontana, CA 92335 6852412.3 Orange, CA 92868-0000 Shilpa Sunil The Sanborn Library has been searched by EDR and maps covering the target property location as provided by Hillmann Environmental Co. were identified for the years listed below. The Sanborn Library is the largest, most complete collection of fire insurance maps. The collection includes maps from Sanborn, Bromley, Perris & Browne, Hopkins, Barlow, and others. Only Environmental Data Resources Inc. (EDR) is authorized to grant rights for commercial reproduction of maps by the Sanborn Library LLC, the copyright holder for the collection. Results can be authenticated by visiting www.edrnet.com/sanborn. The Sanborn Library is continually enhanced with newly identified map archives. This report accesses all maps in the collection as of the day this report was generated. DF1E-4D6F-B3EB NA Maps Provided: C3-8909 Certification #: DF1E-4D6F-B3EB Hillmann Environmental Co. (the client) is permitted to make up to FIVE photocopies of this Sanborn Map transmittal and each fire insurance map accompanying this report solely for the limited use of its customer. No one other than the client is authorized to make copies. Upon request made directly to an EDR Account Executive, the client may be permitted to make a limited number of additional photocopies. This permission is conditioned upon compliance by the client, its customer and their agents with EDR's copyright policy; a copy of which is available upon request. This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2022 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission. 6852412 3 2 page- Sanborn Sheet Key This Certified Sanborn Map Report is based upon the following Sanborn Fire Insurance map sheets. 1938 Source Sheets 1938 Volume 1, Sheet 18 1929 Source Sheets 1929 Volume 1, Sheet 18 6852412 3 3 This Certified Sanborn Map combines the following sheets. Outlined areas indicate map sheets within the collection.0 Feet 150 300 600 - page Certified Sanborn® Map DF1E-4D6F-B3EBDF1E-4D6F-B3EB 1938 1938 Order Date:02/09/2022 Certification # Site Name: Address: 14387 Valley Boulevard 14387 Valley Boulevard City, ST, ZIP:Fontana, CA 92335 EDR Inquiry:6852412.3 Client:Hillmann Environmental Co. Copyright Volume 1, Sheet 18 6852412 3 4 This Certified Sanborn Map combines the following sheets. Outlined areas indicate map sheets within the collection.0 Feet 150 300 600 - page Certified Sanborn® Map DF1E-4D6F-B3EBDF1E-4D6F-B3EB 1929 1929 Order Date:02/09/2022 Certification # Site Name: Address: 14387 Valley Boulevard 14387 Valley Boulevard City, ST, ZIP:Fontana, CA 92335 EDR Inquiry:6852412.3 Client:Hillmann Environmental Co. Copyright Volume 1, Sheet 18 6852412 3 5 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Inquiry Number: 6852412.5 February 09, 2022 The EDR-City Directory Abstract 6 Armstrong Road Shelton, CT 06484 800.352.0050 www.edrnet.comEnvironmental Data Resources IncEnvironmental Data Resources IncEnvironmental Data Resources IncEnvironmental Data Resources Inc TABLE OF CONTENTS SECTION Executive Summary Findings City Directory Images Thank you for your business. Please contact EDR at 1-800-352-0050 with any questions or comments. Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OR DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providing any facts regarding, or prediction orforecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2020 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc. or its affiliates is prohibited without prior written permission. EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. EXECUTIVE SUMMARY DESCRIPTION Environmental Data Resources, Inc.’s (EDR) City Directory Abstract is a screening tool designed to assist environmental professionals in evaluating potential liability on a target property resulting from past activities. EDR’s City Directory Abstract includes a search and abstract of available city directory data. For each address, the directory lists the name of the corresponding occupant at five year intervals. Business directories including city, cross reference and telephone directories were reviewed, if available, at approximately five year intervals for the years spanning 1922 through 2017. This report compiles information gathered in this review by geocoding the latitude and longitude of properties identified and gathering information about properties within 660 feet of the target property. A summary of the information obtained is provided in the text of this report. RECORD SOURCES EDR's Digital Archive combines historical directory listings from sources such as Cole Information and Dun & Bradstreet. These standard sources of property information complement and enhance each other to provide a more comprehensive report. EDR is licensed to reproduce certain City Directory works by the copyright holders of those works. The purchaser of this EDR City Directory Report may include it in report(s) delivered to a customer. Reproduction of City Directories without permission of the publisher or licensed vendor may be a violation of copyright. RESEARCH SUMMARY The following research sources were consulted in the preparation of this report. An "X" indicates where information was identified in the source and provided in this report. Source TPYear Adjoining Text Abstract Source Image 2017 Cole Information Services -X X - Cole Information Services X X X - 2014 Cole Information Services -X X - Cole Information Services X X X - 2009 Cole Information Services -X X - Cole Information Services X X X - 2008 Haines Company, Inc.-X X - Haines Company, Inc.X X X - 2004 Cole Information Services -X X - Cole Information Services X X X - 6852412-5 Page 1 EXECUTIVE SUMMARY Source TPYear Adjoining Text Abstract Source Image 2003 Haines & Co Publishers -X X - Haines & Co Publishers X X X - 2002 SBC PACIFIC BELL -X X - SBC PACIFIC BELL X X X - 1999 Cole Information Services -X X - Cole Information Services X X X - 1996 Pacific Bell -X X - Pacific Bell X X X - 1995 GTE Directories ---- 1994 Cole Information Services -X X - Cole Information Services X X X - 1991 GTE California Incorporated -X X - 1990 Pacific Bell -X X - Pacific Bell X X X - 1985 GTE ---- 1981 General Telephone Company of California ---- 1980 GTE ---- 1975 Pacific Telephone Co -X X - 1970 General Telephone Company of California -X X - General Telephone Company of California X X X - 1965 Luskey Brothers & Co -X X - 1964 Luskey Brothers & Co ---- 1961 Luskey Brothers& Co Publishers ---- 1960 Luskey Brothers & Co Publishers ---- 1956 General Telephone Company Publishers ---- 1955 The Pacific Telephone and Telegraph Co -X X - The Pacific Telephone and Telegraph Co X X X - 1951 Los Angeles Directory Co Publishers ---- 1950 The Pacific Telephone and Telegraph Co ---- 1949 San Bernardino Directory Co. Publishers ---- 1946 Los Angeles Directory Company Publishers ---- 1945 Southern Califronia Telephone Company ---- 1942 San Bernardino Directory Co Publisher ---- 1941 Associated Telephone Company Limited ---- 1940 Los Angeles Directory Co.---- 1938 Los Angeles Directory Co.---- 6852412-5 Page 2 EXECUTIVE SUMMARY Source TPYear Adjoining Text Abstract Source Image 1936 San Bernardino Directory Co Publisher ---- 1934 Los Angeles Directory Co.---- 1931 Los Angeles Directory Co.---- 1930 San Bernardino Directory Co Publisher ---- 1926 Los Angeles Directory Co.---- 1923 Los Angeles Directory Company ---- 1922 R.L. Polk & Co Publishers ---- 6852412-5 Page 3 FINDINGS TARGET PROPERTY INFORMATION ADDRESS 14387 Valley Boulevard Fontana, CA 92335 FINDINGS DETAIL Target Property research detail. VALLEY 14387 VALLEY Year Uses Source 1970 BREMMER ENTERPRISES General Telephone Company of California 1955 Union Store The Pacific Telephone and Telegraph Co VALLEY BLVD 14387 VALLEY BLVD Year Uses Source 2017 GREAT DANE TRAILERS Cole Information Services 2014 GREAT DANE TRAILERS Cole Information Services 2009 GREAT DANE LIMITED PARTNERSHIP Cole Information Services GREAT DANE TRAILERS INC Cole Information Services 2008 GREAT DANE TRAILERS Haines Company, Inc. 2004 OCCUPANT UNKNOWN Cole Information Services STORAGE TRAILER SYSTEMS Cole Information Services 2003 GREAT DANE TRAILERS Haines & Co Publishers STORAGE TRAILER SYSTEMS Haines & Co Publishers 2002 GREAT DANE TRAILERS SBC PACIFIC BELL STORAGE TRAILER SYSTEMS SBC PACIFIC BELL 1999 PINES TRAILER SALES Cole Information Services STORAGE TRAILER SYSTEMS Cole Information Services 1996 PINES TRAILER SALES Pacific Bell STORAGE TRAILER SYSTEMS Pacific Bell 1994 PINES TRAILER SALES Cole Information Services 6852412-5 Page 4 Year Uses Source FINDINGS Year Uses Source 1994 STORAGE TRAILER SYSTEMS Cole Information Services 1990 PINES TRAILER SALES Pacific Bell STORAGE TRAILER SYSTEMS Pacific Bell 6852412-5 Page 5 FINDINGS ADJOINING PROPERTY DETAIL The following Adjoining Property addresses were researched for this report. Detailed findings are provided for each address. 10217 ALMOND AVE 1 10217 ALMOND AVE Year Uses Source 1991 Bogert GTE California Incorporated ALMOND 10090 ALMOND Year Uses Source 1970 Summers Jerry General Telephone Company of California 10136 ALMOND Year Uses Source 1955 Couch Hobson The Pacific Telephone and Telegraph Co 10146 ALMOND Year Uses Source 1955 Scott John The Pacific Telephone and Telegraph Co 10182 ALMOND Year Uses Source 1975 Roberts Jas M Pacific Telephone Co 1970 Roberts Jas M General Telephone Company of California 10190 ALMOND Year Uses Source 1955 Cayton Clarence F The Pacific Telephone and Telegraph Co 10198 ALMOND Year Uses Source 1975 Gorby Carl M Pacific Telephone Co 6852412-5 Page 6 Year Uses Source FINDINGS 10209 ALMOND Year Uses Source 1970 Romero Ralph General Telephone Company of California ALMOND AVE 10136 ALMOND AVE Year Uses Source 2017 PARKWAY FINANCIAL SERVICES Cole Information Services 2014 CARS PLUS Cole Information Services PARKWAY FINANCIAL SERVICES Cole Information Services 2009 AMIRGROUP TRADING Cole Information Services AIRPORT AUTO SALES INC Cole Information Services 2008 CARS PLUS Haines Company, Inc. PARKWAY FINANCIAL SERVICES Haines Company, Inc. PARKWAY FINANCIAL SERVICES Haines Company, Inc. 2003 VALENTI Frank Haines & Co Publishers 1999 OCCUPANT UNKNOWN Cole Information Services 1996 PACIFIC EMPIRE VOLVO TRUCK & GMC TRUCK Pacific Bell 1991 SOUTHLAND WHOLESALE GTE California Incorporated 1990 SOUTHLAND WHOLESALE Pacific Bell 1965 Dixon Frank L Anne steel wkr Kaiser Steel h Luskey Brothers & Co 10146 ALMOND AVE Year Uses Source 2009 ALMA REGLA Cole Information Services 2008 SIMCOX Jeffrey Haines Company, Inc. 2004 LILLIANA ROZZI Cole Information Services 2003 SIMCOX Jeffrey Haines & Co Publishers 1999 ALMA REGLA Cole Information Services 1965 Parra Frank Dolores h Luskey Brothers & Co 10154 ALMOND AVE Year Uses Source 2017 MARIO ARIAS Cole Information Services 6852412-5 Page 7 Year Uses Source FINDINGS Year Uses Source 2014 MARIO ARIAS Cole Information Services 2009 MARIO ARIAS Cole Information Services 2008 ARIAS Mario Haines Company, Inc. 2004 NORA BECK Cole Information Services 2003 BECK Robert Haines & Co Publishers 1999 MARIO ARIAS Cole Information Services 1996 Arias R Pacific Bell 1965 Gorgie Frank W Shirley crane opr Kaiser Steel h Luskey Brothers & Co 10164 ALMOND AVE Year Uses Source 2017 CARMEN DELGADO Cole Information Services 2014 MOHAMMAD MAHMOUDI Cole Information Services 2009 RENATO MARTINEZ Cole Information Services 2008 MARTINEZ Renato Haines Company, Inc. 2004 RENATO MARTINEZ Cole Information Services 2003 VILLA Armida Haines & Co Publishers 2002 Villa Armida SBC PACIFIC BELL 1999 RENATO MARTINEZ Cole Information Services 1965 Hill Norman B Wanda carp CO Dainels Constr Sn B h Luskey Brothers & Co 10172 ALMOND AVE Year Uses Source 2014 JORGE LOPEZ Cole Information Services 2009 KERIN BERMUDEZ Cole Information Services 2008 BERMUDEZ Kerin Haines Company, Inc. 2004 ANGEL ROJAS Cole Information Services 2003 ROJAS Angel Haines & Co Publishers 2002 Rojas Angel SBC PACIFIC BELL 1999 KERIN BERMUDEZ Cole Information Services 1965 Carter Wayne F Lula burr hand Bertes El Mnt h Luskey Brothers & Co 6852412-5 Page 8 Year Uses Source FINDINGS 10182 ALMOND AVE Year Uses Source 2014 LUIS CONTRERAS Cole Information Services 2009 PRIMITIVO ESTRADA Cole Information Services 2008 ESTRADA Primitivo Haines Company, Inc. 2004 PRIMITIVO ESTRADA Cole Information Services 1999 PRIMITIVO ESTRADA Cole Information Services 1965 Roberts James M Bonnie hooker Kaiser St I h Luskey Brothers & Co 10190 ALMOND AVE Year Uses Source 2017 DAPHNE PERDOMO Cole Information Services 2014 DAPHNE PERDOMO Cole Information Services 2009 MEDINA ARZOLA Cole Information Services 2008 PERDOMO Daphne Haines Company, Inc. RZOLA Medina D Haines Company, Inc. 2004 MEDINA ARZOLA Cole Information Services 2003 PERDOMO Daphne Haines & Co Publishers ARZOLA Medina D Haines & Co Publishers 2002 Arzola Medina Damian SBC PACIFIC BELL 1999 MEDINA ARZOLA Cole Information Services 10198 ALMOND AVE Year Uses Source 2017 ANARDA RODAS Cole Information Services 2014 ANARDA RODAS Cole Information Services 2009 ARELI CANALES Cole Information Services 2008 RODAS Anarda Haines Company, Inc. 2004 JAVIER MIRANDA Cole Information Services 2003 RODAS Anarda Haines & Co Publishers 1999 OCCUPANT UNKNOWN Cole Information Services ARELI CANALES Cole Information Services PRIME EXTERMINATORS INCORPORATED Cole Information Services 1994 BUG SHOOTERS PEST CONTROL Cole Information Services 6852412-5 Page 9 Year Uses Source FINDINGS Year Uses Source 1991 BUG SHOOTERS PEST CONTROL GTE California Incorporated 1990 BUG SHOOTERS PEST CONTROL Pacific Bell PRIME EXTERMINATORS INC Pacific Bell 1965 Cox Darold D Patsy lab Kaiser Steel h Luskey Brothers & Co 10201 ALMOND AVE Year Uses Source 2017 KEVIN AUSSEF Cole Information Services 2014 KEVIN AUSSEF Cole Information Services 2008 XXXX Haines Company, Inc. 2003 ROMERO Walter Haines & Co Publishers 1999 OCCUPANT UNKNOWN Cole Information Services 1996 Moreno Anthony S Pacific Bell 1975 Lehr Larry Pacific Telephone Co 1965 Jacobs Ellis atndt Douglas Serv Sta h Luskey Brothers & Co 10203 ALMOND AVE Year Uses Source 2009 BILL SEAGRAVE Cole Information Services 2008 XXXX Haines Company, Inc. 2003 KEEN Edward H Haines & Co Publishers 2002 Keen Edward H SBC PACIFIC BELL 1999 BILL SEAGRAVE Cole Information Services OCCUPANT UNKNOWN Cole Information Services 1965 Roth Dorothy L ret h Luskey Brothers & Co 10205 ALMOND AVE Year Uses Source 2017 JAMES MELENDEZ Cole Information Services 2014 GABRIEL TORRES Cole Information Services 2009 OCCUPANT UNKNOWN Cole Information Services 2008 WILLIAMS Sarah Haines Company, Inc. 2004 OCCUPANT UNKNOWN Cole Information Services 2003 XXXX Haines & Co Publishers 6852412-5 Page 10 Year Uses Source FINDINGS 10207 ALMOND AVE Year Uses Source 2017 MOSES CAMPOSANO Cole Information Services 2014 OCCUPANT UNKNOWN Cole Information Services 2003 WALKER Mildred M Haines & Co Publishers 2002 Walker Mildred M SBC PACIFIC BELL 1999 OCCUPANT UNKNOWN Cole Information Services 1975 Odermann Clifton Pacific Telephone Co 10209 ALMOND AVE Year Uses Source 2014 OCCUPANT UNKNOWN Cole Information Services 2004 OCCUPANT UNKNOWN Cole Information Services 2002 Waggoner Lup SBC PACIFIC BELL 1994 BENJAMIN, ROBERT Cole Information Services 10211 ALMOND AVE Year Uses Source 2008 XXXX Haines Company, Inc. 2003 XXXX Haines & Co Publishers 10213 ALMOND AVE Year Uses Source 2017 DONIKA ODEN Cole Information Services 2014 OCCUPANT UNKNOWN Cole Information Services 2009 OCCUPANT UNKNOWN Cole Information Services 2004 OCCUPANT UNKNOWN Cole Information Services 1975 Lambert Tom Pacific Telephone Co 10215 ALMOND AVE Year Uses Source 2014 RICARDO MARTINEZ Cole Information Services 2009 C MORRIS Cole Information Services 2008 MORRIS C Haines Company, Inc. 2004 MELISSA MARTINEZ Cole Information Services 2003 XXXX Haines & Co Publishers 6852412-5 Page 11 Year Uses Source FINDINGS Year Uses Source 1999 OCCUPANT UNKNOWN Cole Information Services C MORRIS Cole Information Services 1975 Stotts Chas Pacific Telephone Co Stotz Glenn E Pacific Telephone Co 10217 ALMOND AVE Year Uses Source 2017 THOMAS HARTE Cole Information Services 2014 ROGER HARTE Cole Information Services 2009 ROGER HARTE Cole Information Services 2008 DOUCETTE Phil Haines Company, Inc. HARTE T Haines Company, Inc. 2003 XXXX Haines & Co Publishers 1999 OCCUPANT UNKNOWN Cole Information Services ROGER HARTE Cole Information Services 10219 ALMOND AVE Year Uses Source 2017 BROOKE BURNS Cole Information Services 2014 BROOKE BURNS Cole Information Services 2009 REBECCA RENTERIA Cole Information Services 2004 REBECCA RENTERIA Cole Information Services 1999 REBECCA RENTERIA Cole Information Services OCCUPANT UNKNOWN Cole Information Services 10221 ALMOND AVE Year Uses Source 2014 CECILIA ROJAS Cole Information Services 2009 SARAH WILLIAMS Cole Information Services 1999 OCCUPANT UNKNOWN Cole Information Services SARAH WILLIAMS Cole Information Services 10229 ALMOND AVE Year Uses Source 2017 FRANK RIVERA Cole Information Services 6852412-5 Page 12 Year Uses Source FINDINGS Year Uses Source 2014 ELI MARTINEZ Cole Information Services 2009 KERI MARTINEZ Cole Information Services 2004 ROGER HARTE Cole Information Services 1999 KERI MARTINEZ Cole Information Services 1994 HEWSTON, CHARLES R Cole Information Services 10231 ALMOND AVE Year Uses Source 2014 OCCUPANT UNKNOWN Cole Information Services 2009 IRENE RAMOS Cole Information Services 2004 OCCUPANT UNKNOWN Cole Information Services 1999 IRENE RAMOS Cole Information Services OCCUPANT UNKNOWN Cole Information Services RAILERS 14392 VALLEY BLVD 8 RAILERS 14392 VALLEY BLVD Year Uses Source 1991 FRUEHAUF GTE California Incorporated VALLEY 14282 VALLEY Year Uses Source 1970 W W Trucking Co General Telephone Company of California 14284 VALLEY Year Uses Source 1975 ALLYN TRANSPORTATION CO 4 Pacific Telephone Co 1970 Allyn Transportation Co General Telephone Company of California ALLYN TRANSPORTATION CO General Telephone Company of California 14292 VALLEY Year Uses Source 1970 Margiot Cleo General Telephone Company of California 6852412-5 Page 13 Year Uses Source FINDINGS 14307 VALLEY Year Uses Source 1955 Horton Evelyn The Pacific Telephone and Telegraph Co 14313 VALLEY Year Uses Source 1970 Cottage Inn General Telephone Company of California 14336 VALLEY Year Uses Source 1975 Lee Robt E Pacific Telephone Co 1955 Douthwaite Anne The Pacific Telephone and Telegraph Co 14405 VALLEY Year Uses Source 1955 Reed W M The Pacific Telephone and Telegraph Co Shipley John R The Pacific Telephone and Telegraph Co 14447 VALLEY Year Uses Source 1970 Kirshberger F W General Telephone Company of California Ailegranza Ovilio General Telephone Company of California 1955 Allegranza Ovilio The Pacific Telephone and Telegraph Co VALLEY BLVD 14282 VALLEY BLVD Year Uses Source 2003 XXXX Haines & Co Publishers 1990 BEASON TRAILER SALES Pacific Bell 14284 VALLEY BLVD Year Uses Source 2003 XXXX Haines & Co Publishers 1970 Allyn Transportation Co General Telephone Company of California 1965 Hollinzsworth Trucking Co Luskey Brothers & Co Allyn Transportation Co Luskey Brothers & Co 6852412-5 Page 14 Year Uses Source FINDINGS 14292 VALLEY BLVD Year Uses Source 2003 XXXX Haines & Co Publishers 1965 Margiot Cleo Mrs ret h Luskey Brothers & Co 14315 VALLEY BLVD Year Uses Source 2017 RUSH TRUCKS CENTER FONTANA USED TRUC Cole Information Services 2014 RUSH TRUCKS CENTER FONTANA USED TRUC Cole Information Services 2009 DIVERSIFIED SALES SERVICE Cole Information Services 2008 POWER TRUCK INC Haines Company, Inc. 2004 DIVERSIFIED SALES SERVICE CORP Cole Information Services ELLEN BROWN Cole Information Services 2003 DIVERSFD SALES SERVICE CORP Haines & Co Publishers 2002 DIVERSIFIED SALES SERVICE SBC PACIFIC BELL 1999 DIVERSIFIED SALES SERVICE CORPORATION Cole Information Services 1996 DIVERSIFIED SALES SERVICE CORP Pacific Bell 1994 FONTANA TRAILER MART Cole Information Services TBS SALES & LEASING Cole Information Services 1990 FONTANA TRAILER MART Pacific Bell TBS SALES & LEASING Pacific Bell 14336 VALLEY BLVD Year Uses Source 2014 GILBERT VASQUEZ Cole Information Services 2009 GILBERT VASQUEZ Cole Information Services 2004 BENIGNO REYES Cole Information Services 2003 REYES Benigno Haines & Co Publishers 1999 GILBERT VASQUEZ Cole Information Services 1996 Beltz T J Pacific Bell 1994 CLARK, CLYDE G Cole Information Services 1990 CLARKS AUTO ELECTRIC Pacific Bell 6852412-5 Page 15 Year Uses Source FINDINGS 14363 VALLEY BLVD Year Uses Source 2003 XXXX Haines & Co Publishers 14369 VALLEY BLVD Year Uses Source 2014 RON PAPCUN Cole Information Services 14392 VALLEY BLVD Year Uses Source 2017 LOCAL GARAGE DOOR REPAIR Cole Information Services 2014 SCHNEIDER NATIONAL Cole Information Services 2009 SCHNEIDER NATIONAL INC Cole Information Services 2004 OCCUPANT UNKNOWN Cole Information Services 2003 XXXX Haines & Co Publishers 1996 FRUEHAUF TRAILERS Pacific Bell 1994 FRUEHAUF TRAILER CO Cole Information Services 1991 Fruehauf Trailer Operations Fruehauf Corporation GTE California Incorporated Or GTE California Incorporated 1990 FRUEHAUF TRAILER OPERATIONS FRUEHAUF Pacific Bell 14405 VALLEY BLVD Year Uses Source 1965 Mc Williams Charles C h Luskey Brothers & Co 14447 VALLEY BLVD Year Uses Source 2003 XXXX Haines & Co Publishers 1965 Lumnley Clarence C Marce Ilaret h rear Luskey Brothers & Co 14454 VALLEY BLVD Year Uses Source 2017 CARLS JR Cole Information Services 2014 CARLS JR Cole Information Services 2009 CARL KARCHER ENTERPRISES INC Cole Information Services 6852412-5 Page 16 Year Uses Source FINDINGS Year Uses Source 2009 CARLS JR RESTAURANTS Cole Information Services 2008 CARLS JR RESTAURANTS Haines Company, Inc. 2004 CARLS JR RESTAURANTS CORP Cole Information Services 2003 CARLS JR RESTAURANTS Haines & Co Publishers 2002 CARL S JR RESTAURANTS SBC PACIFIC BELL 14455 VALLEY BLVD Year Uses Source 2017 CHEVRON Cole Information Services 2014 FONTANA CHEVRON Cole Information Services CHEVRON STATION EXTRA MILE FONTANA Cole Information Services 2009 TRUCK TUB Cole Information Services FONTANA CHEVRON Cole Information Services 2008 FONTANA CHEVRON Haines Company, Inc. 2004 AHMAD MASRI Cole Information Services 2003 MASRI Ahmad Haines & Co Publishers 1994 TRUCK TUB Cole Information Services 1990 TRUCK TUB Pacific Bell VALLEY VIS 14315 VALLEY VIS Year Uses Source 1991 TBS Sales & Leasing GTE California Incorporated 14336 VALLEY VIS Year Uses Source 1991 Clarks Auto Electric GTE California Incorporated 14455 VALLEY VIS Year Uses Source 1991 Truck Tub GTE California Incorporated 6852412-5 Page 17 FINDINGS ADJOINING PROPERTY: ADDRESSES NOT IDENTIFIED IN RESEARCH SOURCE The following Adjoining Property addresses were researched for this report, and the addresses were not identified in research source. Address Researched Address Not Identified in Research Source 1 10217 ALMOND AVE 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10090 ALMOND 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10136 ALMOND 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10136 ALMOND AVE 2017, 2014, 2009, 2004, 2002, 1999, 1995, 1994, 1985, 1981, 1980, 1975, 1970, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10136 ALMOND AVE 2008, 2004, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10146 ALMOND 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10146 ALMOND AVE 2017, 2014, 2009, 2004, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10146 ALMOND AVE 2017, 2014, 2008, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10154 ALMOND AVE 2008, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10154 ALMOND AVE 2017, 2014, 2009, 2004, 2002, 1999, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10164 ALMOND AVE 2017, 2014, 2009, 2004, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10164 ALMOND AVE 2008, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10172 ALMOND AVE 2017, 2008, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10172 ALMOND AVE 2017, 2014, 2009, 2004, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 FINDINGS Address Researched Address Not Identified in Research Source 10182 ALMOND 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10182 ALMOND AVE 2017, 2014, 2009, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10182 ALMOND AVE 2017, 2008, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10190 ALMOND 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10190 ALMOND AVE 2017, 2014, 2009, 2004, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10190 ALMOND AVE 2008, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10198 ALMOND 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10198 ALMOND AVE 2017, 2014, 2009, 2004, 2002, 1999, 1996, 1995, 1994, 1985, 1981, 1980, 1975, 1970, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10198 ALMOND AVE 2008, 2003, 2002, 1996, 1995, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10201 ALMOND AVE 2009, 2008, 2004, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10201 ALMOND AVE 2017, 2014, 2009, 2004, 2002, 1999, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1970, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10203 ALMOND AVE 2017, 2014, 2009, 2004, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10203 ALMOND AVE 2017, 2014, 2008, 2004, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10205 ALMOND AVE 2008, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10205 ALMOND AVE 2017, 2014, 2009, 2004, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10207 ALMOND AVE 2017, 2014, 2009, 2008, 2004, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 FINDINGS Address Researched Address Not Identified in Research Source 10207 ALMOND AVE 2009, 2008, 2004, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10209 ALMOND 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10209 ALMOND AVE 2017, 2014, 2009, 2008, 2004, 2003, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10209 ALMOND AVE 2017, 2009, 2008, 2003, 2002, 1999, 1996, 1995, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10211 ALMOND AVE 2017, 2014, 2009, 2004, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10213 ALMOND AVE 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10213 ALMOND AVE 2008, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10215 ALMOND AVE 2017, 2008, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10215 ALMOND AVE 2017, 2014, 2009, 2004, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10217 ALMOND AVE 2017, 2014, 2009, 2004, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10217 ALMOND AVE 2008, 2004, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10219 ALMOND AVE 2008, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10221 ALMOND AVE 2017, 2008, 2004, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10229 ALMOND AVE 2008, 2003, 2002, 1996, 1995, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 10231 ALMOND AVE 2017, 2008, 2003, 2002, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14282 VALLEY 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 FINDINGS Address Researched Address Not Identified in Research Source 14282 VALLEY BLVD 2017, 2014, 2009, 2008, 2004, 2002, 1999, 1996, 1995, 1994, 1991, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14284 VALLEY 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14284 VALLEY BLVD 2017, 2014, 2009, 2008, 2004, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14292 VALLEY 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14292 VALLEY BLVD 2017, 2014, 2009, 2008, 2004, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14307 VALLEY 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14313 VALLEY 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14315 VALLEY BLVD 2017, 2014, 2009, 2004, 1999, 1995, 1994, 1991, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14315 VALLEY BLVD 2008, 2003, 2002, 1996, 1995, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14315 VALLEY VIS 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14336 VALLEY 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1970, 1965, 1964, 1961, 1960, 1956, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14336 VALLEY BLVD 2017, 2014, 2009, 2008, 2004, 2002, 1999, 1995, 1994, 1991, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14336 VALLEY BLVD 2017, 2008, 2003, 2002, 1996, 1995, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14336 VALLEY VIS 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14363 VALLEY BLVD 2017, 2014, 2009, 2008, 2004, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14369 VALLEY BLVD 2017, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 FINDINGS Address Researched Address Not Identified in Research Source 14392 VALLEY BLVD 2008, 2003, 2002, 1999, 1996, 1995, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14392 VALLEY BLVD 2017, 2014, 2009, 2008, 2004, 2002, 1999, 1995, 1994, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14405 VALLEY 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14405 VALLEY BLVD 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14447 VALLEY 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1965, 1964, 1961, 1960, 1956, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14447 VALLEY BLVD 2017, 2014, 2009, 2008, 2004, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14454 VALLEY BLVD 2017, 2014, 2009, 2004, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14454 VALLEY BLVD 2008, 2003, 2002, 1999, 1996, 1995, 1994, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14455 VALLEY BLVD 2017, 2014, 2009, 2004, 2002, 1999, 1996, 1995, 1994, 1991, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14455 VALLEY BLVD 2008, 2003, 2002, 1999, 1996, 1995, 1991, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 14455 VALLEY VIS 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 8 RAILERS 14392 VALLEY BLVD 2017, 2014, 2009, 2008, 2004, 2003, 2002, 1999, 1996, 1995, 1994, 1990, 1985, 1981, 1980, 1975, 1970, 1965, 1964, 1961, 1960, 1956, 1955, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 TARGET PROPERTY: ADDRESS NOT IDENTIFIED IN RESEARCH SOURCE The following Target Property addresses were researched for this report, and the addresses were not identified in the research source. Address Researched Address Not Identified in Research Source 14387 Valley Boulevard 1995, 1991, 1985, 1981, 1980, 1975, 1965, 1964, 1961, 1960, 1956, 1951, 1950, 1949, 1946, 1945, 1942, 1941, 1940, 1938, 1936, 1934, 1931, 1930, 1926, 1923, 1922 Hillmann Consulting LLC Phase I Environmental Site Assessment Hillmann Project No.: C3-8909 14387 Valley Boulevard, Fontana, California APPENDIX E REGULATORY RECORDS DOCUMENTATION FORM-NULL-PVC tropeR paM suidaR yrammuS RDE 6 Armstrong Road, 4th floor Shelton, CT 06484 Toll Free: 800.352.0050 www.edrnet.com 14387 Valley Boulevard 14387 Valley Boulevard Fontana, CA 92335 Inquiry Number: 06852412.2r February 09, 2022 SECTION PAGE Executive Summary ES1 Overview Map 2 Detail Map 3 Map Findings Summary 4 Map Findings 9 Orphan Summary 1166 Government Records Searched/Data Currency Tracking GR-1 GEOCHECK ADDENDUM Physical Setting Source Addendum A-1 Physical Setting Source Summary A-2 Physical Setting SSURGO Soil Map A-6 Physical Setting Source Map A-9 Physical Setting Source Map Findings A-11 Physical Setting Source Records Searched PSGR-1 TC06852412.2r Page 1 Thank you for your business. Please contact EDR at 1-800-352-0050 with any questions or comments. Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2020 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission. EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. TABLE OF CONTENTS EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 1 A search of available environmental records was conducted by Environmental Data Resources, Inc (EDR). The report was designed to assist parties seeking to meet the search requirements of EPA’s Standards and Practices for All Appropriate Inquiries (40 CFR Part 312), the ASTM Standard Practice for Environmental Site Assessments (E1527-21), the ASTM Standard Practice for Environmental Site Assessments for Forestland or Rural Property (E 2247-16), the ASTM Standard Practice for Limited Environmental Due Diligence: Transaction Screen Process (E 1528-14) or custom requirements developed for the evaluation of environmental risk associated with a parcel of real estate. TARGET PROPERTY INFORMATION ADDRESS 14387 VALLEY BOULEVARD FONTANA, CA 92335 COORDINATES 34.0691670 - 34ˆ 4’ 9.00’’Latitude (North): 117.4915470 - 117ˆ 29’ 29.56’’Longitude (West): Zone 11Universal Tranverse Mercator: 454642.3UTM X (Meters): 3769739.5UTM Y (Meters): 1035 ft. above sea levelElevation: USGS TOPOGRAPHIC MAP ASSOCIATED WITH TARGET PROPERTY TP Target Property: U.S. Geological SurveySource: W Target Property: U.S. Geological SurveySource: AERIAL PHOTOGRAPHY IN THIS REPORT 20140603Portions of Photo from: USDASource: 06852412.2r Page 2 I39 TRUCK TOWN 10238 CA FID UST, CA HIST CORTESE Lower 570, 0.108, SE I38 TRUCK TOWN 10238 CHERRY AVE CA HIST UST, CA San Bern. Co. Permit Lower 570, 0.108, SE I37 TRUCK TOWN 10238 CHERRY AVE CA Cortese, CA HAZNET, CA HWTS Lower 570, 0.108, SE H36 TRANS WEST FORD 10150 CHERRY AVE RCRA NonGen / NLR Higher 567, 0.107, East H35 TRANS WEST FORD TRUC 10150 CHERRY ST CA CERS HAZ WASTE, CA SWEEPS UST, CA HIST UST, CA...Higher 567, 0.107, East D34 ARCO AM/PM 10062 CHERRY AVE CA UST, CA CERS HAZ WASTE, CA CERS TANKS, CA San... Higher 537, 0.102, NE D33 TIME OUT L L C D B A 10062 CHERRY AVE RCRA-SQG, FINDS, ECHO, CA HAZNET, CA HWTS Higher 537, 0.102, NE G32 ANELLE MANAGEMENT SE 14264 VALLEY BLVD RCRA NonGen / NLR Higher 527, 0.100, NW G31 FONTANA TRUCK STOP C 14264 VALLEY BLVD CA UST Higher 527, 0.100, NW G30 IRONMAN RENEWAL DBA 14264 VALLEY BLVD CA HAZNET, CA San Bern. Co. Permit, CA HWTS Higher 527, 0.100, NW G29 FLEETCREW 14264 VALLEY BLVD CA LUST, CA AST, CA CERS HAZ WASTE, CA CERS TANKS,...Higher 527, 0.100, NW G28 FONTANA TRUCK STOP C 14264 VALLEY BLVD EDR Hist Auto Higher 527, 0.100, NW G27 FONTANA TRUCK STOP C 14264 VALLEY BLVD RCRA NonGen / NLR Higher 527, 0.100, NW F26 FONTANA- NATIONAL RE 10268 ALMOND AVE CA CERS HAZ WASTE, CA NPDES, CA San Bern. Co.... Lower 518, 0.098, SW F25 CARRETTA TRUCKING, I 10268 ALMOND AVE CA SWEEPS UST, CA FID UST, CA NPDES, CA CIWQS, CA... Lower 518, 0.098, SW F24 NATIONAL RETAIL TRAN 10268 ALMOND AVE RCRA NonGen / NLR Lower 518, 0.098, SW F23 YRC LOGISTICS (744-L 10268 ALMOND ST CA HIST UST, CA San Bern. Co. Permit Lower 518, 0.098, SW E22 FONTANA CHEVRON CA23 14455 VALLEY BLVD EDR Hist Auto Higher 453, 0.086, ENE E21 FONTANA CHEVRON 14455 VALLEY BLVD RCRA NonGen / NLR Higher 453, 0.086, ENE E20 FONTANA CHEVRON 14455 VALLEY BLVD CA ENF, CA San Bern. Co. Permit, CA CIWQS, CA CERS Higher 453, 0.086, ENE E19 FONTANA CHEVRON 14455 VALLEY BLVD CA CERS HAZ WASTE, CA CERS TANKS, CA HAZNET, CA... Higher 453, 0.086, ENE E18 FONTANA CHEVRON 14455 VALLEY BLVD CA UST Higher 453, 0.086, ENE D17 RESTAURANT,FONTANA 14454 VALLEY BLVD. CA San Bern. Co. Permit, CA CERS Higher 393, 0.074, NE C16 RUSH TRUCK CENTERS - 14315 VALLEY BLVD RCRA NonGen / NLR Higher 140, 0.027, NW C15 RUSH TRUCK CENTERS - 14315 VALLEY BLVD CA CERS HAZ WASTE, CA HAZNET, CA San Bern. Co.... Higher 140, 0.027, NW B14 SCHNEIDER NATIONAL, 14392 VALLEY BLVD CA UST Higher 139, 0.026, NNE B13 KNIGHT-SWIFT TRANSPO 14392 VALLEY BLVD. RCRA NonGen / NLR Higher 139, 0.026, NNE B12 SWIFT TRANSPORTATION 14392 VALLEY BLVD CA AST, CA CERS HAZ WASTE, CA CERS TANKS, CA... Higher 139, 0.026, NNE B11 SWIFT TRANSPORTATION 14392 VALLEY BLVD RCRA NonGen / NLR Higher 139, 0.026, NNE B10 SWIFT TRANSPORTATION 14392 VALLEY BLVD CA UST Higher 139, 0.026, NNE B9 SCHNEIDER NATIONAL, 14392 VALLEY BLVD RCRA NonGen / NLR, FINDS, ECHO, CA NPDES, CA CIWQS Higher 139, 0.026, NNE B8 KNIGHT-SWIFT TRANSPO 14392 VALLEY BLVD. RCRA NonGen / NLR Higher 139, 0.026, NNE B7 TRANS WEST TRUCK CEN 14435 VALLEY BOULEVA CA NPDES, CA CIWQS Higher 1 ft. B6 TRANS WEST TRUCK CEN 14435 VALLEY BOULEVA FINDS, ECHO Higher 1 ft. A5 GREAT DANE LIMITED P 14387 VALLEY BLVD CA HAULERS TP A4 GREAT DANE TRAILERS 14387 VALLEY BLVD ECHO TP A3 GREAT DANE TRAILERS 14387 VALLEY BLVD CA HWTS TP A2 GREAT DANE TRAILERS 14387 VALLEY BLVD FINDS TP A1 GREAT DANE TRAILERS 14387 VALLEY BLVD RCRA NonGen / NLR TP MAPPED SITES SUMMARY Target Property Address: 14387 VALLEY BOULEVARD FONTANA, CA 92335 Click on Map ID to see full detail. MAP RELATIVE DIST (ft. & mi.) ID DATABASE ACRONYMS ELEVATION DIRECTIONSITE NAME ADDRESS 06852412.2r Page 3 Q78 CARGO SOLUTION EXPRE 14587 VALLEY BLVD CA CERS HAZ WASTE, CA CERS TANKS, CA NPDES, CA San...Higher 1174, 0.222, East Q77 CARGO SOLUTION EXPRE 14587 VALLEY BLVD RCRA NonGen / NLR Higher 1174, 0.222, East Q76 CONTINENTAL DPF RADI 14589 VALLEY BLVD RCRA NonGen / NLR Higher 1173, 0.222, East P75 BIG RIG TRUCK REPAIR 14578 VALLEY BLVD CA HAZNET, CA San Bern. Co. Permit, CA HWTS Higher 1155, 0.219, ENE P74 BIG RIG TRUCK REPAIR 14578 VALLEY BLVD RCRA-SQG, FINDS, ECHO Higher 1155, 0.219, ENE 73 TOM’S TRUCK REPAIR 14546 HUNTER AVE CA San Bern. Co. Permit Higher 1140, 0.216, NE N72 CARRIER TRANSICOLD O 9979 CHERRY AVE CA SWEEPS UST, CA FID UST, CA HAZNET, CA San Bern.... Higher 1125, 0.213, NE N71 CARRIER TRANSICOLD O 9979 CHERRY AVE RCRA NonGen / NLR Higher 1125, 0.213, NE O70 AT&T MOBILITY - (USI 14560 WASHINGTON DR CA CERS HAZ WASTE, CA San Bern. Co. Permit, CA... Higher 1064, 0.202, ESE O69 AT&T MOBILITY 14560 WASHINGTON ST RCRA NonGen / NLR Higher 1064, 0.202, ESE N68 RENE’S TIRE SERVICE 10007 CHERRY AVE CA CERS HAZ WASTE, CA San Bern. Co. Permit, CA... Higher 1014, 0.192, NE L67 UPLAND FREIGHT LINES 9993 ALMOND AVE CA HIST UST Higher 998, 0.189, NNW L66 MORGAN CORP 9993 ALMOND AVE RCRA-SQG, CA SWEEPS UST, CA HIST UST, CA FID UST,... Higher 998, 0.189, NNW N65 EMPIRE SPEEDO & TACH 9996 CHERRY AVE CA San Bern. Co. Permit Higher 991, 0.188, NE M64 C & M STEEL 10312 ALMOND AVE CA San Bern. Co. Permit Lower 991, 0.188, SW M63 FLEET SERVICES GROUP 10312 ALMOND AVE CA CERS HAZ WASTE, CA NPDES, CA San Bern. Co.... Lower 991, 0.188, SW L62 BTE FUEL STOP 10002 ALMOND AVE CA LUST, CA UST Higher 854, 0.162, NNW L61 ACTION TRUCKING 10002 ALMOND CA HIST UST Higher 854, 0.162, NNW L60 KEHR, DOUG 10002 ALMONT B CA SWEEPS UST Higher 854, 0.162, NNW L59 LAMPKINS, MARK 10002 ALMOND CA SWEEPS UST, CA FID UST Higher 854, 0.162, NNW L58 KEHR, DOUG 10002 ALMONT CA FID UST Higher 854, 0.162, NNW J57 FINDLY CHEMICAL DISP 14226 1/2 VALLEY BLV TX Ind. Haz Waste Higher 820, 0.155, WNW J56 ACTION AUC DISPOSAL 14226 1/2 VALLEY BLV RCRA NonGen / NLR, FINDS, ECHO Higher 820, 0.155, WNW G55 CLEAN ENERGY - 13695 14230 VALLEY BLVD CA San Bern. Co. Permit, CA CERS Higher 792, 0.150, WNW K54 SON’S MOBIL STATION 14518 VALLEY BLVD CA UST Higher 775, 0.147, ENE K53 MOBIL STATION 14518 VALLEY BLVD CA LUST, CA SWEEPS UST, CA Cortese, CA HIST... Higher 775, 0.147, ENE K52 ABRAHAM RIDA 14518 VALLEY BLVD CA HIST UST Higher 775, 0.147, ENE K51 FONTANA CV MARKET, I 14518 VALLEY BLVD RCRA NonGen / NLR Higher 775, 0.147, ENE K50 FONTANA CV MARKET, I 14518 VALLEY BLVD CA CERS HAZ WASTE, CA CERS TANKS, CA FID UST, CA... Higher 775, 0.147, ENE K49 FONTANA CV MARKET, I 14518 VALLEY BLVD CA UST Higher 775, 0.147, ENE J48 PETE’S ROAD SERVICE 14239 VALLEY BLVD CA HAULERS, CA CERS HAZ WASTE, CA HAZNET, CA San...Lower 756, 0.143, West J47 PETE’S ROAD SERVICE 14239 VALLEY BLVD RCRA NonGen / NLR Lower 756, 0.143, West H46 ARROW TRUCK SALES IN 10175 CHERRY AVE RCRA NonGen / NLR Higher 742, 0.141, ESE H45 ARROW TRUCK SALES, I 10175 CHERRY AVE CA CERS HAZ WASTE, CA San Bern. Co. Permit, CA... Higher 742, 0.141, ESE I44 A F TIRE SERVICE 10283 CHERRY AVE RCRA-SQG, FINDS, ECHO Higher 738, 0.140, ESE I43 TRUCK TOWN 10238 CHERRY AVE CA LUST, CA SWEEPS UST, CA San Bern. Co. Permit,... Lower 570, 0.108, SE I42 TRUCK TOWN & TRUCKAD 10238 CHERRY AVE CA UST Lower 570, 0.108, SE I41 FULLRICH DEVELOPMENT 10238 CHERRY AVE EDR Hist Auto Lower 570, 0.108, SE I40 TRUCK TOWN AND TRUCK 10238 CHERRY AVE CA HIST UST, CA HAZNET, CA HWTS Lower 570, 0.108, SE MAPPED SITES SUMMARY Target Property Address: 14387 VALLEY BOULEVARD FONTANA, CA 92335 Click on Map ID to see full detail. MAP RELATIVE DIST (ft. & mi.) ID DATABASE ACRONYMS ELEVATION DIRECTIONSITE NAME ADDRESS 06852412.2r Page 4 Z108 KAISER STEEL - CHEMW 9400 CHERRY AVENUE CA HIST Cal-Sites Higher 4884, 0.925, North Z107 KAISER STEEL-EAST SL 9400 CHERRY AVENUE CA HIST Cal-Sites, CA BOND EXP. PLAN Higher 4884, 0.925, North Z106 KAISER STEEL - BYPRO 9400 CHERRY AVENUE CA HIST Cal-Sites Higher 4884, 0.925, North Z105 KAISER STEEL - TAR P 9400 CHERRY AVENUE CA ENVIROSTOR, CA SWF/LF, CA CPS-SLIC, CA VCP, CA... Higher 4884, 0.925, North Z104 KAISER VENTURES, INC 13429 SAN BERNARDINO SEMS-ARCHIVE, CORRACTS, RCRA-TSDF, US INST... Higher 4884, 0.925, North Y103 ERICKSON INC 13738 SLOVER AVE SEMS-ARCHIVE, CORRACTS, RCRA-SQG, FINDS, ECHO, CA...Lower 4595, 0.870, WSW Y102 ECOLOGY CONTROL INDU 13738 SLOVER AVE CA ENVIROSTOR, CA San Bern. Co. Permit Lower 4595, 0.870, WSW 101 CONSTRUCTION STEEL W 10665 REDWOOD AVENUE CA ENVIROSTOR, CA EMI, CA HAZNET, CA San Bern. Co.... Lower 3747, 0.710, SSE X100 CALIFORNIA STEEL IND 14000 SAN BERNARDINO CA RESPONSE, CA ENVIROSTOR, CA LUST, CA CERS HAZ...Higher 3595, 0.681, NW X99 CALIFORNIA STEEL SUP 14000 SAN BERNARDINO CA HIST Cal-Sites, TSCA, ICIS, US AIRS, FINDS,... Higher 3595, 0.681, NW 98 AZ FUEL STOP 14529 SAN BERNARDINO CA LUST, CA CERS HAZ WASTE, CA SWEEPS UST, CA FID...Higher 2493, 0.472, NNE 97 ECOLOGY AUTO PARTS 14187 SLOVER AVE CA SWRCY, CA CERS HAZ WASTE, CA CERS TANKS, CA... Lower 2316, 0.439, SSW 96 CIRCLE K STORE #514 14527 SLOVER ST RCRA-SQG, CA LUST, CA CERS HAZ WASTE, CA SWEEPS...Lower 2204, 0.417, SSE 95 RANCHO DISPOSAL SERV 9820 CHERRY AVE. CA SWF/LF, CA RGA LUST Higher 2006, 0.380, NNE W94 NORTH AMERICAN VAN L 14320 SLOVER AVENUE RCRA-SQG, CA LUST, CA SWEEPS UST, CA FID UST, CA... Lower 1958, 0.371, SSW W93 FLEET SERVICE OF LOS 14320 SLOVER AVE CA LUST, CA HIST UST, CA CERS Lower 1958, 0.371, SSW V92 LEND LEASE FACILITY 14 416 SLOVER RCRA-SQG, CA LUST, CA CERS HAZ WASTE, CA SWEEPS...Lower 1953, 0.370, South V91 TRANS-WEST CARRIERS 14396 SLOVER AVE CA LUST, CA Cortese, CA HIST CORTESE, CA CERS Lower 1915, 0.363, South U90 SWIFT TRANSPORTATION 9951 BANANA ST CA LUST, CA Cortese, CA HIST CORTESE Higher 1885, 0.357, NW U89 SWIFT TRANSPORTATION 9951 BANANA AVE RCRA-SQG, CA LUST, FINDS, ECHO, CA Cortese, CA... Higher 1885, 0.357, NW T88 PIPELINE TRUCKING CO 9813 ALMOND AVE CA LUST, CA San Bern. Co. Permit Higher 1737, 0.329, North T87 PIPELINE TRUCKING CO 9813 ALMOND AVE CA LUST, CA SWEEPS UST, CA FID UST, CA Cortese, CA... Higher 1737, 0.329, North S86 RANCHO DISPOSAL SERV CA LOS ANGELES CO LF METHANE Higher 1715, 0.325, NNE S85 RANCHO DISPOSAL INC 9890 CHERRY AVE CA SWF/LF, CA LUST, CA UST, CA HAULERS, CA SWEEPS...Higher 1694, 0.321, NNE R84 BURRTEC WASTE INDUST 9950 CHERRY AVE CA LUST, CA Cortese, CA HIST CORTESE, CA CERS Higher 1522, 0.288, NNE R83 BURRTEC WASTE INDUST CA LOS ANGELES CO LF METHANE Higher 1348, 0.255, NNE 82 TEC EQUIPMENT, INC. 14166 VALLEY BLVD RCRA NonGen / NLR Lower 1278, 0.242, WNW P81 CONTINENTAL DPF SERV 14601 VALLEY BLVD CA CERS HAZ WASTE, CA San Bern. Co. Permit, CA... Higher 1239, 0.235, ENE N80 BANANA STREET PIT 9900 BLOCK OF BANANA SEMS-ARCHIVE Higher 1234, 0.234, NE O79 BOYCE FOREST PRODUCT 14570 WASHINGTON DR CA San Bern. Co. Permit Higher 1182, 0.224, ESE MAPPED SITES SUMMARY Target Property Address: 14387 VALLEY BOULEVARD FONTANA, CA 92335 Click on Map ID to see full detail. MAP RELATIVE DIST (ft. & mi.) ID DATABASE ACRONYMS ELEVATION DIRECTIONSITE NAME ADDRESS EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 5 TARGET PROPERTY SEARCH RESULTS The target property was identified in the following records. For more information on this property see page 9 of the attached EDR Radius Map report: EPA IDDatabase(s)Site GREAT DANE TRAILERS 14387 VALLEY BLVD FONTANA, CA 92335 CAC003054798RCRA NonGen / NLR EPA ID:: CAC003054798 GREAT DANE TRAILERS 14387 VALLEY BLVD FONTANA, CA 92335 N/AFINDS GREAT DANE TRAILERS 14387 VALLEY BLVD FONTANA, CA 92335 N/ACA HWTS GREAT DANE TRAILERS 14387 VALLEY BLVD FONTANA, CA 92335 N/AECHO Registry ID: 110070725060 GREAT DANE LIMITED P 14387 VALLEY BLVD FONTANA, CA N/ACA HAULERS Facility ID: 1052519 SURROUNDING SITES: SEARCH RESULTS Surrounding sites were identified in the following databases. Elevations have been determined from the USGS Digital Elevation Model and should be evaluated on a relative (not an absolute) basis. Relative elevation information between sites of close proximity should be field verified. Sites with an elevation equal to or higher than the target property have been differentiated below from sites with an elevation lower than the target property. Page numbers and map identification numbers refer to the EDR Radius Map report where detailed data on individual sites can be reviewed. Sites listed in bold italics are in multiple databases. Unmappable (orphan) sites are not considered in the foregoing analysis. STANDARD ENVIRONMENTAL RECORDS Lists of Federal CERCLA sites with NFRAP SEMS-ARCHIVE: A review of the SEMS-ARCHIVE list, as provided by EDR, and dated 10/20/2021 has EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 6 revealed that there is 1 SEMS-ARCHIVE site within approximately 0.5 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ BANANA STREET PIT 9900 BLOCK OF BANANA NE 1/8 - 1/4 (0.234 mi.) N80 29 Site ID: 0900016 EPA Id: CAD983566696 Lists of Federal RCRA facilities undergoing Corrective Action CORRACTS: A review of the CORRACTS list, as provided by EDR, and dated 09/13/2021 has revealed that there are 2 CORRACTS sites within approximately 1 mile of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ KAISER VENTURES, INC 13429 SAN BERNARDINO N 1/2 - 1 (0.925 mi.) Z104 42 EPA ID:: CAD008274938 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ ERICKSON INC 13738 SLOVER AVE WSW 1/2 - 1 (0.870 mi.) Y103 41 EPA ID:: CAD982484933 Lists of Federal RCRA generators RCRA-SQG: A review of the RCRA-SQG list, as provided by EDR, and dated 09/13/2021 has revealed that there are 4 RCRA-SQG sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ TIME OUT L L C D B A 10062 CHERRY AVE NE 0 - 1/8 (0.102 mi.) D33 16 EPA ID:: CAR000124107 A F TIRE SERVICE 10283 CHERRY AVE ESE 1/8 - 1/4 (0.140 mi.) I44 19 EPA ID:: CAD983594136 MORGAN CORP 9993 ALMOND AVE NNW 1/8 - 1/4 (0.189 mi.) L66 25 EPA ID:: CAD982011736 BIG RIG TRUCK REPAIR 14578 VALLEY BLVD ENE 1/8 - 1/4 (0.219 mi.) P74 27 EPA ID:: CAD982347940 Lists of state- and tribal (Superfund) equivalent sites CA RESPONSE: A review of the CA RESPONSE list, as provided by EDR, has revealed that there is 1 CA RESPONSE site within approximately 1 mile of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ CALIFORNIA STEEL IND 14000 SAN BERNARDINO NW 1/2 - 1 (0.681 mi.) X100 39 Database: RESPONSE, Date of Government Version: 10/25/2021 EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 7 Facility Id: 36330046 Status: Active Lists of state- and tribal hazardous waste facilities CA ENVIROSTOR: A review of the CA ENVIROSTOR list, as provided by EDR, and dated 10/25/2021 has revealed that there are 4 CA ENVIROSTOR sites within approximately 1 mile of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ CALIFORNIA STEEL IND 14000 SAN BERNARDINO NW 1/2 - 1 (0.681 mi.) X100 39 Facility Id: 71004125 Facility Id: 36330046 Facility Id: 71003628 Status: Inactive - Needs Evaluation Status: Active Status: Refer: Other Agency KAISER STEEL - TAR P 9400 CHERRY AVENUE N 1/2 - 1 (0.925 mi.) Z105 43 Facility Id: 60001356 Facility Id: 80001542 Status: Active Status: Certified / Operation & Maintenance PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ CONSTRUCTION STEEL W 10665 REDWOOD AVENUE SSE 1/2 - 1 (0.710 mi.) 101 40 Facility Id: 36340068 Status: Refer: 1248 Local Agency ECOLOGY CONTROL INDU 13738 SLOVER AVE WSW 1/2 - 1 (0.870 mi.) Y102 41 Facility Id: 80001499 Status: No Further Action Lists of state and tribal landfills and solid waste disposal facilities CA SWF/LF: A review of the CA SWF/LF list, as provided by EDR, has revealed that there are 2 CA SWF/LF sites within approximately 0.5 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ RANCHO DISPOSAL INC 9890 CHERRY AVE NNE 1/4 - 1/2 (0.321 mi.) S85 30 Database: LOS ANGELES CO. LF, Date of Government Version: 10/08/2021 Site ID: 229 Status: Active RANCHO DISPOSAL SERV 9820 CHERRY AVE. NNE 1/4 - 1/2 (0.380 mi.) 95 36 Database: LOS ANGELES CO. LF, Date of Government Version: 10/08/2021 Site ID: 3626 Status: Active EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 8 Lists of state and tribal leaking storage tanks CA LUST: A review of the CA LUST list, as provided by EDR, has revealed that there are 16 CA LUST sites within approximately 0.5 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ FLEETCREW 14264 VALLEY BLVD NW 0 - 1/8 (0.100 mi.) G29 15 Database: LUST, Date of Government Version: 09/07/2021 Status: Completed - Case Closed Global Id: T0607111670 MOBIL STATION 14518 VALLEY BLVD ENE 1/8 - 1/4 (0.147 mi.) K53 21 Database: LUST REG 8, Date of Government Version: 02/14/2005 Database: LUST, Date of Government Version: 09/07/2021 Global ID: T0607100245 Status: Completed - Case Closed Status: Open - Assessment & Interim Remedial Action Facility Status: Case Closed Global Id: T0607100245 Global Id: T10000007267 BTE FUEL STOP 10002 ALMOND AVE NNW 1/8 - 1/4 (0.162 mi.) L62 24 Database: LUST REG 8, Date of Government Version: 02/14/2005 Global ID: T0607111670 Facility Status: Pollution Characterization BURRTEC WASTE INDUST 9950 CHERRY AVE NNE 1/4 - 1/2 (0.288 mi.) R84 29 Database: LUST REG 8, Date of Government Version: 02/14/2005 Database: LUST, Date of Government Version: 09/07/2021 Global ID: T0607100405 Status: Completed - Case Closed Facility Status: Case Closed Global Id: T0607100405 RANCHO DISPOSAL INC 9890 CHERRY AVE NNE 1/4 - 1/2 (0.321 mi.) S85 30 Database: LUST REG 8, Date of Government Version: 02/14/2005 Database: LUST, Date of Government Version: 09/07/2021 Global ID: T0607100120 Status: Completed - Case Closed Facility Status: Case Closed Global Id: T0607100120 Global Id: T0607184831 PIPELINE TRUCKING CO 9813 ALMOND AVE N 1/4 - 1/2 (0.329 mi.) T87 31 Database: LUST REG 8, Date of Government Version: 02/14/2005 Global ID: T0607100609 Facility Status: Case Closed PIPELINE TRUCKING CO 9813 ALMOND AVE N 1/4 - 1/2 (0.329 mi.) T88 32 Database: LUST, Date of Government Version: 09/07/2021 Status: Completed - Case Closed Global Id: T0607100609 SWIFT TRANSPORTATION 9951 BANANA AVE NW 1/4 - 1/2 (0.357 mi.) U89 32 Database: LUST, Date of Government Version: 09/07/2021 Status: Open - Site Assessment Status: Completed - Case Closed Global Id: T10000012395 EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 9 Global Id: T0607100570 SWIFT TRANSPORTATION 9951 BANANA ST NW 1/4 - 1/2 (0.357 mi.) U90 33 Database: LUST REG 8, Date of Government Version: 02/14/2005 Global ID: T0607100570 Facility Status: Preliminary site assessment workplan submitted AZ FUEL STOP 14529 SAN BERNARDINO NNE 1/4 - 1/2 (0.472 mi.) 98 38 Database: LUST REG 8, Date of Government Version: 02/14/2005 Database: LUST, Date of Government Version: 09/07/2021 Global ID: T0607100635 Status: Completed - Case Closed Facility Status: Case Closed Global Id: T0607100635 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ TRUCK TOWN 10238 CHERRY AVE SE 0 - 1/8 (0.108 mi.) I43 19 Database: LUST REG 8, Date of Government Version: 02/14/2005 Database: LUST, Date of Government Version: 09/07/2021 Global ID: T0607100455 Status: Completed - Case Closed Facility Status: Preliminary site assessment workplan submitted Global Id: T0607100455 TRANS-WEST CARRIERS 14396 SLOVER AVE S 1/4 - 1/2 (0.363 mi.) V91 33 Database: LUST REG 8, Date of Government Version: 02/14/2005 Database: LUST, Date of Government Version: 09/07/2021 Global ID: T0607100370 Status: Completed - Case Closed Facility Status: Case Closed Global Id: T0607100370 LEND LEASE FACILITY 14 416 SLOVER S 1/4 - 1/2 (0.370 mi.) V92 34 Database: LUST REG 8, Date of Government Version: 02/14/2005 Database: LUST, Date of Government Version: 09/07/2021 Global ID: T0607100026 Status: Completed - Case Closed Facility Status: Pollution Characterization Global Id: T0607100026 FLEET SERVICE OF LOS 14320 SLOVER AVE SSW 1/4 - 1/2 (0.371 mi.) W93 35 Database: LUST, Date of Government Version: 09/07/2021 Status: Completed - Case Closed Global Id: T0607100556 NORTH AMERICAN VAN L 14320 SLOVER AVENUE SSW 1/4 - 1/2 (0.371 mi.) W94 35 Database: LUST REG 8, Date of Government Version: 02/14/2005 Global ID: T0607100556 Facility Status: Case Closed CIRCLE K STORE #514 14527 SLOVER ST SSE 1/4 - 1/2 (0.417 mi.) 96 36 Database: LUST REG 8, Date of Government Version: 02/14/2005 Database: LUST, Date of Government Version: 09/07/2021 Global ID: T0607100535 Status: Completed - Case Closed Facility Status: Remediation Plan Global Id: T0607100535 EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 10 Lists of state and tribal registered storage tanks CA UST: A review of the CA UST list, as provided by EDR, has revealed that there are 9 CA UST sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ SWIFT TRANSPORTATION 14392 VALLEY BLVD NNE 0 - 1/8 (0.026 mi.) B10 11 Database: UST, Date of Government Version: 09/07/2021 Facility Id: FA0006070 SCHNEIDER NATIONAL, 14392 VALLEY BLVD NNE 0 - 1/8 (0.026 mi.) B14 12 Database: UST, Date of Government Version: 09/07/2021 Facility Id: 1049296 FONTANA CHEVRON 14455 VALLEY BLVD ENE 0 - 1/8 (0.086 mi.) E18 12 Database: UST, Date of Government Version: 09/07/2021 Facility Id: FA0003253 FONTANA TRUCK STOP C 14264 VALLEY BLVD NW 0 - 1/8 (0.100 mi.) G31 16 Database: UST, Date of Government Version: 09/07/2021 Facility Id: FA0001593 ARCO AM/PM 10062 CHERRY AVE NE 0 - 1/8 (0.102 mi.) D34 17 Database: UST, Date of Government Version: 09/07/2021 Facility Id: FA0001041 FONTANA CV MARKET, I 14518 VALLEY BLVD ENE 1/8 - 1/4 (0.147 mi.) K49 21 Database: UST, Date of Government Version: 09/07/2021 Facility Id: FA0006288 SON’S MOBIL STATION 14518 VALLEY BLVD ENE 1/8 - 1/4 (0.147 mi.) K54 22 Database: UST, Date of Government Version: 09/07/2021 Facility Id: 86008794 BTE FUEL STOP 10002 ALMOND AVE NNW 1/8 - 1/4 (0.162 mi.) L62 24 Database: UST, Date of Government Version: 09/07/2021 Facility Id: 90023017 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ TRUCK TOWN & TRUCKAD 10238 CHERRY AVE SE 0 - 1/8 (0.108 mi.) I42 19 Database: UST, Date of Government Version: 09/07/2021 Facility Id: FA0006812 CA AST: A review of the CA AST list, as provided by EDR, has revealed that there are 2 CA AST sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ SWIFT TRANSPORTATION 14392 VALLEY BLVD NNE 0 - 1/8 (0.026 mi.) B12 11 Database: AST, Date of Government Version: 07/06/2016 FLEETCREW 14264 VALLEY BLVD NW 0 - 1/8 (0.100 mi.) G29 15 Database: AST, Date of Government Version: 07/06/2016 EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 11 ADDITIONAL ENVIRONMENTAL RECORDS Local Lists of Landfill / Solid Waste Disposal Sites CA SWRCY: A review of the CA SWRCY list, as provided by EDR, and dated 09/07/2021 has revealed that there is 1 CA SWRCY site within approximately 0.5 miles of the target property. PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ ECOLOGY AUTO PARTS 14187 SLOVER AVE SSW 1/4 - 1/2 (0.439 mi.) 97 38 Cert Id: RC262590.001 Local Lists of Hazardous waste / Contaminated Sites CA HIST Cal-Sites: A review of the CA HIST Cal-Sites list, as provided by EDR, and dated 08/08/2005 has revealed that there are 5 CA HIST Cal-Sites sites within approximately 1 mile of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ CALIFORNIA STEEL SUP 14000 SAN BERNARDINO NW 1/2 - 1 (0.681 mi.) X99 39 KAISER STEEL - TAR P 9400 CHERRY AVENUE N 1/2 - 1 (0.925 mi.) Z105 43 KAISER STEEL - BYPRO 9400 CHERRY AVENUE N 1/2 - 1 (0.925 mi.) Z106 44 KAISER STEEL-EAST SL 9400 CHERRY AVENUE N 1/2 - 1 (0.925 mi.) Z107 44 KAISER STEEL - CHEMW 9400 CHERRY AVENUE N 1/2 - 1 (0.925 mi.) Z108 44 CA CERS HAZ WASTE: A review of the CA CERS HAZ WASTE list, as provided by EDR, and dated 10/18/2021 has revealed that there are 15 CA CERS HAZ WASTE sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ SWIFT TRANSPORTATION 14392 VALLEY BLVD NNE 0 - 1/8 (0.026 mi.) B12 11 RUSH TRUCK CENTERS - 14315 VALLEY BLVD NW 0 - 1/8 (0.027 mi.) C15 12 FONTANA CHEVRON 14455 VALLEY BLVD ENE 0 - 1/8 (0.086 mi.) E19 13 FLEETCREW 14264 VALLEY BLVD NW 0 - 1/8 (0.100 mi.) G29 15 ARCO AM/PM 10062 CHERRY AVE NE 0 - 1/8 (0.102 mi.) D34 17 TRANS WEST FORD TRUC 10150 CHERRY ST E 0 - 1/8 (0.107 mi.) H35 17 ARROW TRUCK SALES, I 10175 CHERRY AVE ESE 1/8 - 1/4 (0.141 mi.) H45 20 FONTANA CV MARKET, I 14518 VALLEY BLVD ENE 1/8 - 1/4 (0.147 mi.) K50 21 RENE’S TIRE SERVICE 10007 CHERRY AVE NE 1/8 - 1/4 (0.192 mi.) N68 26 AT&T MOBILITY - (USI 14560 WASHINGTON DR ESE 1/8 - 1/4 (0.202 mi.) O70 26 CARGO SOLUTION EXPRE 14587 VALLEY BLVD E 1/8 - 1/4 (0.222 mi.) Q78 28 CONTINENTAL DPF SERV 14601 VALLEY BLVD ENE 1/8 - 1/4 (0.235 mi.) P81 29 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ FONTANA- NATIONAL RE 10268 ALMOND AVE SW 0 - 1/8 (0.098 mi.) F26 14 PETE’S ROAD SERVICE 14239 VALLEY BLVD W 1/8 - 1/4 (0.143 mi.) J48 20 FLEET SERVICES GROUP 10312 ALMOND AVE SW 1/8 - 1/4 (0.188 mi.) M63 24 EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 12 Local Lists of Registered Storage Tanks CA SWEEPS UST: A review of the CA SWEEPS UST list, as provided by EDR, and dated 06/01/1994 has revealed that there are 8 CA SWEEPS UST sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ TRANS WEST FORD TRUC 10150 CHERRY ST E 0 - 1/8 (0.107 mi.) H35 17 Status: A Tank Status: A Comp Number: 67785 MOBIL STATION 14518 VALLEY BLVD ENE 1/8 - 1/4 (0.147 mi.) K53 21 Status: A Tank Status: A Comp Number: 39217 LAMPKINS, MARK 10002 ALMOND NNW 1/8 - 1/4 (0.162 mi.) L59 23 Status: A Tank Status: A Comp Number: 63340 KEHR, DOUG 10002 ALMONT B NNW 1/8 - 1/4 (0.162 mi.) L60 23 Status: A Tank Status: A Comp Number: 8793 MORGAN CORP 9993 ALMOND AVE NNW 1/8 - 1/4 (0.189 mi.) L66 25 Status: A Tank Status: A Comp Number: 46352 CARRIER TRANSICOLD O 9979 CHERRY AVE NE 1/8 - 1/4 (0.213 mi.) N72 26 Status: A Tank Status: A Comp Number: 11263 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ CARRETTA TRUCKING, I 10268 ALMOND AVE SW 0 - 1/8 (0.098 mi.) F25 14 Status: A Tank Status: A Comp Number: 65963 TRUCK TOWN 10238 CHERRY AVE SE 0 - 1/8 (0.108 mi.) I43 19 Status: A Tank Status: A Comp Number: 56226 CA HIST UST: A review of the CA HIST UST list, as provided by EDR, and dated 10/15/1990 has revealed that there are 8 CA HIST UST sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ TRANS WEST FORD TRUC 10150 CHERRY ST E 0 - 1/8 (0.107 mi.) H35 17 EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 13 Facility Id: 00000067785 ABRAHAM RIDA 14518 VALLEY BLVD ENE 1/8 - 1/4 (0.147 mi.) K52 21 Facility Id: 00000039217 ACTION TRUCKING 10002 ALMOND NNW 1/8 - 1/4 (0.162 mi.) L61 24 Facility Id: 00000063340 MORGAN CORP 9993 ALMOND AVE NNW 1/8 - 1/4 (0.189 mi.) L66 25 UPLAND FREIGHT LINES 9993 ALMOND AVE NNW 1/8 - 1/4 (0.189 mi.) L67 25 Facility Id: 00000046352 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ YRC LOGISTICS (744-L 10268 ALMOND ST SW 0 - 1/8 (0.098 mi.) F23 13 Facility Id: 00000065963 TRUCK TOWN 10238 CHERRY AVE SE 0 - 1/8 (0.108 mi.) I38 18 Facility Id: 00000056226 TRUCK TOWN AND TRUCK 10238 CHERRY AVE SE 0 - 1/8 (0.108 mi.) I40 18 CA FID UST: A review of the CA FID UST list, as provided by EDR, and dated 10/31/1994 has revealed that there are 8 CA FID UST sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ TRANS WEST FORD TRUC 10150 CHERRY ST E 0 - 1/8 (0.107 mi.) H35 17 Facility Id: 36004792 Status: A FONTANA CV MARKET, I 14518 VALLEY BLVD ENE 1/8 - 1/4 (0.147 mi.) K50 21 Facility Id: 36000395 Status: A KEHR, DOUG 10002 ALMONT NNW 1/8 - 1/4 (0.162 mi.) L58 23 Facility Id: 36008465 Status: A LAMPKINS, MARK 10002 ALMOND NNW 1/8 - 1/4 (0.162 mi.) L59 23 Facility Id: 36001418 Status: A MORGAN CORP 9993 ALMOND AVE NNW 1/8 - 1/4 (0.189 mi.) L66 25 Facility Id: 36003799 Status: A CARRIER TRANSICOLD O 9979 CHERRY AVE NE 1/8 - 1/4 (0.213 mi.) N72 26 Facility Id: 36000921 Status: A PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ CARRETTA TRUCKING, I 10268 ALMOND AVE SW 0 - 1/8 (0.098 mi.) F25 14 Facility Id: 36002938 Status: A TRUCK TOWN 10238 SE 0 - 1/8 (0.108 mi.) I39 18 Facility Id: 36002369 Status: A EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 14 CA CERS TANKS: A review of the CA CERS TANKS list, as provided by EDR, and dated 10/18/2021 has revealed that there are 6 CA CERS TANKS sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ SWIFT TRANSPORTATION 14392 VALLEY BLVD NNE 0 - 1/8 (0.026 mi.) B12 11 FONTANA CHEVRON 14455 VALLEY BLVD ENE 0 - 1/8 (0.086 mi.) E19 13 FLEETCREW 14264 VALLEY BLVD NW 0 - 1/8 (0.100 mi.) G29 15 ARCO AM/PM 10062 CHERRY AVE NE 0 - 1/8 (0.102 mi.) D34 17 FONTANA CV MARKET, I 14518 VALLEY BLVD ENE 1/8 - 1/4 (0.147 mi.) K50 21 CARGO SOLUTION EXPRE 14587 VALLEY BLVD E 1/8 - 1/4 (0.222 mi.) Q78 28 Other Ascertainable Records RCRA NonGen / NLR: A review of the RCRA NonGen / NLR list, as provided by EDR, and dated 09/13/2021 has revealed that there are 19 RCRA NonGen / NLR sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ KNIGHT-SWIFT TRANSPO 14392 VALLEY BLVD. NNE 0 - 1/8 (0.026 mi.) B8 10 SCHNEIDER NATIONAL, 14392 VALLEY BLVD NNE 0 - 1/8 (0.026 mi.) B9 10 EPA ID:: CA0000133868 SWIFT TRANSPORTATION 14392 VALLEY BLVD NNE 0 - 1/8 (0.026 mi.) B11 11 EPA ID:: CAL000419760 KNIGHT-SWIFT TRANSPO 14392 VALLEY BLVD. NNE 0 - 1/8 (0.026 mi.) B13 11 RUSH TRUCK CENTERS - 14315 VALLEY BLVD NW 0 - 1/8 (0.027 mi.) C16 12 EPA ID:: CAL000416240 FONTANA CHEVRON 14455 VALLEY BLVD ENE 0 - 1/8 (0.086 mi.) E21 13 EPA ID:: CAL000335857 FONTANA TRUCK STOP C 14264 VALLEY BLVD NW 0 - 1/8 (0.100 mi.) G27 15 EPA ID:: CAL000366717 ANELLE MANAGEMENT SE 14264 VALLEY BLVD NW 0 - 1/8 (0.100 mi.) G32 16 EPA ID:: CAL000416674 TRANS WEST FORD 10150 CHERRY AVE E 0 - 1/8 (0.107 mi.) H36 17 EPA ID:: CAL000346556 ARROW TRUCK SALES IN 10175 CHERRY AVE ESE 1/8 - 1/4 (0.141 mi.) H46 20 EPA ID:: CAL000429451 FONTANA CV MARKET, I 14518 VALLEY BLVD ENE 1/8 - 1/4 (0.147 mi.) K51 21 ACTION AUC DISPOSAL 14226 1/2 VALLEY BLV WNW 1/8 - 1/4 (0.155 mi.) J56 22 EPA ID:: CAD982515827 AT&T MOBILITY 14560 WASHINGTON ST ESE 1/8 - 1/4 (0.202 mi.) O69 26 EPA ID:: CAL000423552 CARRIER TRANSICOLD O 9979 CHERRY AVE NE 1/8 - 1/4 (0.213 mi.) N71 26 EPA ID:: CAL000411670 CONTINENTAL DPF RADI 14589 VALLEY BLVD E 1/8 - 1/4 (0.222 mi.) Q76 28 EPA ID:: CAL000417770 CARGO SOLUTION EXPRE 14587 VALLEY BLVD E 1/8 - 1/4 (0.222 mi.) Q77 28 EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 15 EPA ID:: CAL000286022 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ NATIONAL RETAIL TRAN 10268 ALMOND AVE SW 0 - 1/8 (0.098 mi.) F24 14 EPA ID:: CAL000436290 PETE’S ROAD SERVICE 14239 VALLEY BLVD W 1/8 - 1/4 (0.143 mi.) J47 20 EPA ID:: CAL000183331 TEC EQUIPMENT, INC. 14166 VALLEY BLVD WNW 1/8 - 1/4 (0.242 mi.) 82 29 EPA ID:: CAC002995711 CONSENT: A review of the CONSENT list, as provided by EDR, and dated 09/30/2021 has revealed that there is 1 CONSENT site within approximately 1 mile of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ KAISER VENTURES, INC 13429 SAN BERNARDINO N 1/2 - 1 (0.925 mi.) Z104 42 FINDS: A review of the FINDS list, as provided by EDR, and dated 05/05/2021 has revealed that there is 1 FINDS site within approximately 0.001 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ TRANS WEST TRUCK CEN 14435 VALLEY BOULEVA 0 - 1/8 (0.000 mi.) B6 10 Registry ID:: 110070092494 ECHO: A review of the ECHO list, as provided by EDR, and dated 01/01/2022 has revealed that there is 1 ECHO site within approximately 0.001 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ TRANS WEST TRUCK CEN 14435 VALLEY BOULEVA 0 - 1/8 (0.000 mi.) B6 10 Registry ID: 110070092494 CA BOND EXP. PLAN: A review of the CA BOND EXP. PLAN list, as provided by EDR, and dated 01/01/1989 has revealed that there is 1 CA BOND EXP. PLAN site within approximately 1 mile of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ KAISER STEEL-EAST SL 9400 CHERRY AVENUE N 1/2 - 1 (0.925 mi.) Z107 44 EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 16 CA Cortese: A review of the CA Cortese list, as provided by EDR, and dated 09/20/2021 has revealed that there are 13 CA Cortese sites within approximately 0.5 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ FLEETCREW 14264 VALLEY BLVD NW 0 - 1/8 (0.100 mi.) G29 15 Cleanup Status: COMPLETED - CASE CLOSED MOBIL STATION 14518 VALLEY BLVD ENE 1/8 - 1/4 (0.147 mi.) K53 21 Cleanup Status: OPEN - ASSESSMENT & INTERIM REMEDIAL ACTION Cleanup Status: COMPLETED - CASE CLOSED BURRTEC WASTE INDUST 9950 CHERRY AVE NNE 1/4 - 1/2 (0.288 mi.) R84 29 Cleanup Status: COMPLETED - CASE CLOSED RANCHO DISPOSAL INC 9890 CHERRY AVE NNE 1/4 - 1/2 (0.321 mi.) S85 30 Cleanup Status: COMPLETED - CASE CLOSED PIPELINE TRUCKING CO 9813 ALMOND AVE N 1/4 - 1/2 (0.329 mi.) T87 31 Cleanup Status: COMPLETED - CASE CLOSED SWIFT TRANSPORTATION 9951 BANANA AVE NW 1/4 - 1/2 (0.357 mi.) U89 32 Cleanup Status: OPEN - SITE ASSESSMENT SWIFT TRANSPORTATION 9951 BANANA ST NW 1/4 - 1/2 (0.357 mi.) U90 33 Cleanup Status: COMPLETED - CASE CLOSED AZ FUEL STOP 14529 SAN BERNARDINO NNE 1/4 - 1/2 (0.472 mi.) 98 38 Cleanup Status: COMPLETED - CASE CLOSED PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ TRUCK TOWN 10238 CHERRY AVE SE 0 - 1/8 (0.108 mi.) I37 18 Cleanup Status: COMPLETED - CASE CLOSED TRANS-WEST CARRIERS 14396 SLOVER AVE S 1/4 - 1/2 (0.363 mi.) V91 33 Cleanup Status: COMPLETED - CASE CLOSED LEND LEASE FACILITY 14 416 SLOVER S 1/4 - 1/2 (0.370 mi.) V92 34 Cleanup Status: COMPLETED - CASE CLOSED NORTH AMERICAN VAN L 14320 SLOVER AVENUE SSW 1/4 - 1/2 (0.371 mi.) W94 35 Cleanup Status: COMPLETED - CASE CLOSED CIRCLE K STORE #514 14527 SLOVER ST SSE 1/4 - 1/2 (0.417 mi.) 96 36 Cleanup Status: COMPLETED - CASE CLOSED CA HIST CORTESE: A review of the CA HIST CORTESE list, as provided by EDR, and dated 04/01/2001 has revealed that there are 11 CA HIST CORTESE sites within approximately 0.5 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ MOBIL STATION 14518 VALLEY BLVD ENE 1/8 - 1/4 (0.147 mi.) K53 21 Reg Id: 083602008T BURRTEC WASTE INDUST 9950 CHERRY AVE NNE 1/4 - 1/2 (0.288 mi.) R84 29 Reg Id: 083602791T RANCHO DISPOSAL INC 9890 CHERRY AVE NNE 1/4 - 1/2 (0.321 mi.) S85 30 Reg Id: 083601088T PIPELINE TRUCKING CO 9813 ALMOND AVE N 1/4 - 1/2 (0.329 mi.) T87 31 EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 17 Reg Id: 083603581T SWIFT TRANSPORTATION 9951 BANANA ST NW 1/4 - 1/2 (0.357 mi.) U90 33 Reg Id: 083603442T AZ FUEL STOP 14529 SAN BERNARDINO NNE 1/4 - 1/2 (0.472 mi.) 98 38 Reg Id: 083603646T PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ TRUCK TOWN 10238 SE 0 - 1/8 (0.108 mi.) I39 18 Reg Id: 083603062T TRANS-WEST CARRIERS 14396 SLOVER AVE S 1/4 - 1/2 (0.363 mi.) V91 33 Reg Id: 083602631T LEND LEASE FACILITY 14 416 SLOVER S 1/4 - 1/2 (0.370 mi.) V92 34 Reg Id: 083600225T NORTH AMERICAN VAN L 14320 SLOVER AVENUE SSW 1/4 - 1/2 (0.371 mi.) W94 35 Reg Id: 083603402T CIRCLE K STORE #514 14527 SLOVER ST SSE 1/4 - 1/2 (0.417 mi.) 96 36 Reg Id: 083603351T CA HWP: A review of the CA HWP list, as provided by EDR, and dated 11/15/2021 has revealed that there are 3 CA HWP sites within approximately 1 mile of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ CALIFORNIA STEEL IND 14000 SAN BERNARDINO NW 1/2 - 1 (0.681 mi.) X100 39 EPA ID: CAD118352921 Cleanup Status: CLOSED KAISER VENTURES, INC 13429 SAN BERNARDINO N 1/2 - 1 (0.925 mi.) Z104 42 EPA ID: CAD008274938 Cleanup Status: POST CLOSURE PERMIT PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ ERICKSON INC 13738 SLOVER AVE WSW 1/2 - 1 (0.870 mi.) Y103 41 EPA ID: CAD982484933 Cleanup Status: CLOSED TX Ind. Haz Waste: A review of the TX Ind. Haz Waste list, as provided by EDR, and dated 09/14/2021 has revealed that there is 1 TX Ind. Haz Waste site within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ FINDLY CHEMICAL DISP 14226 1/2 VALLEY BLV WNW 1/8 - 1/4 (0.155 mi.) J57 23 Registration Number: 41014 EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 18 CA NPDES: A review of the CA NPDES list, as provided by EDR, and dated 11/09/2021 has revealed that there is 1 CA NPDES site within approximately 0.001 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ TRANS WEST TRUCK CEN 14435 VALLEY BOULEVA 0 - 1/8 (0.000 mi.) B7 10 CA San Bern. Co. Permit: A review of the CA San Bern. Co. Permit list, as provided by EDR, and dated 08/11/2021 has revealed that there are 27 CA San Bern. Co. Permit sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ SWIFT TRANSPORTATION 14392 VALLEY BLVD NNE 0 - 1/8 (0.026 mi.) B12 11 Facility Status: ACTIVE Facility Status: INACTIVE Facility Id: FA0006070 RUSH TRUCK CENTERS - 14315 VALLEY BLVD NW 0 - 1/8 (0.027 mi.) C15 12 Facility Status: ACTIVE Facility Id: FA0016890 RESTAURANT,FONTANA 14454 VALLEY BLVD. NE 0 - 1/8 (0.074 mi.) D17 12 Facility Status: INACTIVE Facility Id: FA0012459 FONTANA CHEVRON 14455 VALLEY BLVD ENE 0 - 1/8 (0.086 mi.) E20 13 Facility Status: ACTIVE Facility Id: FA0003253 FLEETCREW 14264 VALLEY BLVD NW 0 - 1/8 (0.100 mi.) G29 15 Facility Status: ACTIVE Facility Status: INACTIVE Facility Id: FA0013211 Facility Id: FA0001593 Facility Id: FA0010879 IRONMAN RENEWAL DBA 14264 VALLEY BLVD NW 0 - 1/8 (0.100 mi.) G30 16 Facility Status: ACTIVE Facility Id: FA0017031 ARCO AM/PM 10062 CHERRY AVE NE 0 - 1/8 (0.102 mi.) D34 17 Facility Status: ACTIVE Facility Id: FA0001041 TRANS WEST FORD TRUC 10150 CHERRY ST E 0 - 1/8 (0.107 mi.) H35 17 Facility Status: ACTIVE Facility Status: INACTIVE Facility Id: FA0006773 ARROW TRUCK SALES, I 10175 CHERRY AVE ESE 1/8 - 1/4 (0.141 mi.) H45 20 Facility Status: ACTIVE Facility Id: FA0015139 FONTANA CV MARKET, I 14518 VALLEY BLVD ENE 1/8 - 1/4 (0.147 mi.) K50 21 Facility Status: ACTIVE Facility Status: INACTIVE Facility Id: FA0006288 CLEAN ENERGY - 13695 14230 VALLEY BLVD WNW 1/8 - 1/4 (0.150 mi.) G55 22 EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 19 Facility Status: ACTIVE Facility Id: FA0015983 EMPIRE SPEEDO & TACH 9996 CHERRY AVE NE 1/8 - 1/4 (0.188 mi.) N65 25 Facility Status: INACTIVE Facility Id: FA0002915 RENE’S TIRE SERVICE 10007 CHERRY AVE NE 1/8 - 1/4 (0.192 mi.) N68 26 Facility Status: ACTIVE Facility Status: INACTIVE Facility Id: FA0011289 Facility Id: FA0006694 AT&T MOBILITY - (USI 14560 WASHINGTON DR ESE 1/8 - 1/4 (0.202 mi.) O70 26 Facility Status: ACTIVE Facility Id: FA0016722 CARRIER TRANSICOLD O 9979 CHERRY AVE NE 1/8 - 1/4 (0.213 mi.) N72 26 Facility Status: INACTIVE Facility Id: FA0011789 TOM’S TRUCK REPAIR 14546 HUNTER AVE NE 1/8 - 1/4 (0.216 mi.) 73 27 Facility Status: INACTIVE Facility Id: FA0006708 BIG RIG TRUCK REPAIR 14578 VALLEY BLVD ENE 1/8 - 1/4 (0.219 mi.) P75 27 Facility Status: INACTIVE Facility Id: FA0001468 CARGO SOLUTION EXPRE 14587 VALLEY BLVD E 1/8 - 1/4 (0.222 mi.) Q78 28 Facility Status: ACTIVE Facility Status: FEE EXEMPT Facility Status: INACTIVE Facility Id: FA0013904 BOYCE FOREST PRODUCT 14570 WASHINGTON DR ESE 1/8 - 1/4 (0.224 mi.) O79 28 Facility Status: INACTIVE Facility Id: FA0001546 CONTINENTAL DPF SERV 14601 VALLEY BLVD ENE 1/8 - 1/4 (0.235 mi.) P81 29 Facility Status: ACTIVE Facility Id: FA0017746 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ YRC LOGISTICS (744-L 10268 ALMOND ST SW 0 - 1/8 (0.098 mi.) F23 13 Facility Status: INACTIVE Facility Id: FA0011171 FONTANA- NATIONAL RE 10268 ALMOND AVE SW 0 - 1/8 (0.098 mi.) F26 14 Facility Status: ACTIVE Facility Status: INACTIVE Facility Id: FA0017377 TRUCK TOWN 10238 CHERRY AVE SE 0 - 1/8 (0.108 mi.) I38 18 Facility Status: INACTIVE Facility Id: FA0007402 TRUCK TOWN 10238 CHERRY AVE SE 0 - 1/8 (0.108 mi.) I43 19 Facility Status: INACTIVE Facility Id: FA0006812 PETE’S ROAD SERVICE 14239 VALLEY BLVD W 1/8 - 1/4 (0.143 mi.) J48 20 EXECUTIVE SUMMARY TC06852412.2r EXECUTIVE SUMMARY 20 Facility Status: ACTIVE Facility Id: FA0016599 FLEET SERVICES GROUP 10312 ALMOND AVE SW 1/8 - 1/4 (0.188 mi.) M63 24 Facility Status: ACTIVE Facility Status: INACTIVE Facility Id: FA0017280 Facility Id: FA0012839 C & M STEEL 10312 ALMOND AVE SW 1/8 - 1/4 (0.188 mi.) M64 24 Facility Status: INACTIVE Facility Id: FA0001639 CA PROC: A review of the CA PROC list, as provided by EDR, and dated 06/04/2021 has revealed that there is 1 CA PROC site within approximately 0.5 miles of the target property. PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ ECOLOGY AUTO PARTS 14187 SLOVER AVE SSW 1/4 - 1/2 (0.439 mi.) 97 38 CA CIWQS: A review of the CA CIWQS list, as provided by EDR, and dated 08/30/2021 has revealed that there is 1 CA CIWQS site within approximately 0.001 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ TRANS WEST TRUCK CEN 14435 VALLEY BOULEVA 0 - 1/8 (0.000 mi.) B7 10 EDR HIGH RISK HISTORICAL RECORDS EDR Exclusive Records EDR Hist Auto: A review of the EDR Hist Auto list, as provided by EDR, has revealed that there are 3 EDR Hist Auto sites within approximately 0.125 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ ___________________ _____ _____ FONTANA CHEVRON CA23 14455 VALLEY BLVD ENE 0 - 1/8 (0.086 mi.) E22 13 FONTANA TRUCK STOP C 14264 VALLEY BLVD NW 0 - 1/8 (0.100 mi.) G28 15 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ ___________________ _____ _____ FULLRICH DEVELOPMENT 10238 CHERRY AVE SE 0 - 1/8 (0.108 mi.) I41 19 EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.ORPHAN SUMMARYCityEDR IDSite NameSite AddressZipDatabase(s)Count: 2 records.FONTANA S10752977717468 VALLEY, SPACE 2 (SKYVIEW92335CA CDLSAN BERNARDINO COUNTS1075324383 1/2 MI E OF BEAR VALLEY & HW CA CDLTC06852412.2r Page 1166 EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.60 kV1080 1 0 4 0 1000 9 6 0 1 1 2 0 1120 1120 10 4010401 0 8 0 1080 9 6 0 1000 1000 10 4 0 1040 1 0 4 0 EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc. 1040 10401040 1040 EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc. MAP FINDINGS SUMMARY Search TargetDistance Total Database Property(Miles) < 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1 > 1 Plotted STANDARD ENVIRONMENTAL RECORDS Lists of Federal NPL (Superfund) sites 0 NR 0 0 0 0 1.000NPL 0 NR 0 0 0 0 1.000Proposed NPL 0 NR 0 0 0 0 1.000NPL LIENS Lists of Federal Delisted NPL sites 0 NR 0 0 0 0 1.000Delisted NPL Lists of Federal sites subject to CERCLA removals and CERCLA orders 0 NR NR 0 0 0 0.500FEDERAL FACILITY 0 NR NR 0 0 0 0.500SEMS Lists of Federal CERCLA sites with NFRAP 1 NR NR 0 1 0 0.500SEMS-ARCHIVE Lists of Federal RCRA facilities undergoing Corrective Action 2 NR 2 0 0 0 1.000CORRACTS Lists of Federal RCRA TSD facilities 0 NR NR 0 0 0 0.500RCRA-TSDF Lists of Federal RCRA generators 0 NR NR NR 0 0 0.250RCRA-LQG 4 NR NR NR 3 1 0.250RCRA-SQG 0 NR NR NR 0 0 0.250RCRA-VSQG Federal institutional controls / engineering controls registries 0 NR NR 0 0 0 0.500LUCIS 0 NR NR 0 0 0 0.500US ENG CONTROLS 0 NR NR 0 0 0 0.500US INST CONTROLS Federal ERNS list 0 NR NR NR NR 0 0.001ERNS Lists of state- and tribal (Superfund) equivalent sites 1 NR 1 0 0 0 1.000CA RESPONSE Lists of state- and tribal hazardous waste facilities 4 NR 4 0 0 0 1.000CA ENVIROSTOR Lists of state and tribal landfills and solid waste disposal facilities 2 NR NR 2 0 0 0.500CA SWF/LF TC06852412.2r Page 4 MAP FINDINGS SUMMARY Search TargetDistance Total Database Property(Miles) < 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1 > 1 Plotted Lists of state and tribal leaking storage tanks 16 NR NR 12 2 2 0.500CA LUST 0 NR NR 0 0 0 0.500INDIAN LUST 0 NR NR 0 0 0 0.500CA CPS-SLIC Lists of state and tribal registered storage tanks 0 NR NR NR 0 0 0.250FEMA UST 9 NR NR NR 3 6 0.250CA UST 2 NR NR NR 0 2 0.250CA AST 0 NR NR NR 0 0 0.250INDIAN UST Lists of state and tribal voluntary cleanup sites 0 NR NR 0 0 0 0.500CA VCP 0 NR NR 0 0 0 0.500INDIAN VCP Lists of state and tribal brownfield sites 0 NR NR 0 0 0 0.500CA BROWNFIELDS ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists 0 NR NR 0 0 0 0.500US BROWNFIELDS Local Lists of Landfill / Solid Waste Disposal Sites 0 NR NR 0 0 0 0.500CA WMUDS/SWAT 1 NR NR 1 0 0 0.500CA SWRCY 1 NR NR NR NR 0 0.001 1CA HAULERS 0 NR NR 0 0 0 0.500INDIAN ODI 0 NR NR 0 0 0 0.500ODI 0 NR NR 0 0 0 0.500DEBRIS REGION 9 0 NR NR 0 0 0 0.500IHS OPEN DUMPS Local Lists of Hazardous waste / Contaminated Sites 0 NR NR NR NR 0 0.001US HIST CDL 5 NR 5 0 0 0 1.000CA HIST Cal-Sites 0 NR NR NR 0 0 0.250CA SCH 0 NR NR NR NR 0 0.001CA CDL 0 NR 0 0 0 0 1.000CA Toxic Pits 15 NR NR NR 8 7 0.250CA CERS HAZ WASTE 0 NR NR NR NR 0 0.001US CDL 0 NR NR 0 0 0 0.500CA PFAS 0 NR NR NR NR NR TPCA AQUEOUS FOAM Local Lists of Registered Storage Tanks 8 NR NR NR 5 3 0.250CA SWEEPS UST 8 NR NR NR 4 4 0.250CA HIST UST 8 NR NR NR 5 3 0.250CA FID UST TC06852412.2r Page 5 MAP FINDINGS SUMMARY Search TargetDistance Total Database Property(Miles) < 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1 > 1 Plotted 6 NR NR NR 2 4 0.250CA CERS TANKS Local Land Records 0 NR NR NR NR 0 0.001CA LIENS 0 NR NR NR NR 0 0.001LIENS 2 0 NR NR 0 0 0 0.500CA DEED Records of Emergency Release Reports 0 NR NR NR NR 0 0.001HMIRS 0 NR NR NR NR 0 0.001CA CHMIRS 0 NR NR NR NR 0 0.001CA LDS 0 NR NR NR NR 0 0.001CA MCS 0 NR NR NR NR 0 0.001CA SPILLS 90 Other Ascertainable Records 20 NR NR NR 9 10 0.250 1RCRA NonGen / NLR 0 NR 0 0 0 0 1.000FUDS 0 NR 0 0 0 0 1.000DOD 0 NR NR 0 0 0 0.500SCRD DRYCLEANERS 0 NR NR NR NR 0 0.001US FIN ASSUR 0 NR NR NR NR 0 0.001EPA WATCH LIST 0 NR NR NR 0 0 0.2502020 COR ACTION 0 NR NR NR NR 0 0.001TSCA 0 NR NR NR NR 0 0.001TRIS 0 NR NR NR NR 0 0.001SSTS 0 NR 0 0 0 0 1.000ROD 0 NR NR NR NR 0 0.001RMP 0 NR NR NR NR 0 0.001RAATS 0 NR NR NR NR 0 0.001PRP 0 NR NR NR NR 0 0.001PADS 0 NR NR NR NR 0 0.001ICIS 0 NR NR NR NR 0 0.001FTTS 0 NR NR NR NR 0 0.001MLTS 0 NR NR NR NR 0 0.001COAL ASH DOE 0 NR NR 0 0 0 0.500COAL ASH EPA 0 NR NR NR NR 0 0.001PCB TRANSFORMER 0 NR NR NR NR 0 0.001RADINFO 0 NR NR NR NR 0 0.001HIST FTTS 0 NR NR NR NR 0 0.001DOT OPS 1 NR 1 0 0 0 1.000CONSENT 0 NR 0 0 0 0 1.000INDIAN RESERV 0 NR 0 0 0 0 1.000FUSRAP 0 NR NR 0 0 0 0.500UMTRA 0 NR NR NR NR 0 0.001LEAD SMELTERS 0 NR NR NR NR 0 0.001US AIRS 0 NR NR NR 0 0 0.250US MINES 0 NR NR NR 0 0 0.250ABANDONED MINES 2 NR NR NR NR 1 0.001 1FINDS 2 NR NR NR NR 1 0.001 1ECHO 0 NR NR NR NR 0 0.001DOCKET HWC 0 NR 0 0 0 0 1.000UXO TC06852412.2r Page 6 MAP FINDINGS SUMMARY Search TargetDistance Total Database Property(Miles) < 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1 > 1 Plotted 0 NR NR NR 0 0 0.250FUELS PROGRAM 1 NR 1 0 0 0 1.000CA BOND EXP. PLAN 13 NR NR 10 1 2 0.500CA Cortese 0 NR NR NR 0 0 0.250CA CUPA Listings 0 NR NR NR 0 0 0.250CA DRYCLEANERS 0 NR NR NR NR 0 0.001CA EMI 0 NR NR NR NR 0 0.001CA ENF 0 NR NR NR NR 0 0.001CA Financial Assurance 0 NR NR NR NR 0 0.001CA HAZNET 0 NR NR NR NR 0 0.001CA ICE 11 NR NR 9 1 1 0.500CA HIST CORTESE 3 NR 3 0 0 0 1.000CA HWP 0 NR NR NR 0 0 0.250CA HWT 1 NR NR NR 1 0 0.250TX Ind. Haz Waste 0 NR NR NR 0 0 0.250CA MINES 0 NR NR NR 0 0 0.250CA MWMP 1 NR NR NR NR 1 0.001CA NPDES 27 NR NR NR 15 12 0.250CA San Bern. Co. Permit 0 NR NR NR NR 0 0.001CA PEST LIC 1 NR NR 1 0 0 0.500CA PROC 0 NR 0 0 0 0 1.000CA Notify 65 0 NR NR NR NR 0 0.001CA UIC 0 NR NR NR NR 0 0.001CA UIC GEO 0 NR NR 0 0 0 0.500CA WASTEWATER PITS 0 NR NR NR NR 0 0.001CA WDS 0 NR NR NR 0 0 0.250CA WIP 0 NR NR NR NR 0 0.001CA MILITARY PRIV SITES 0 NR NR NR NR 0 0.001CA PROJECT 0 NR NR NR NR 0 0.001CA WDR 1 NR NR NR NR 1 0.001CA CIWQS 0 NR NR NR NR 0 0.001CA CERS 0 NR NR NR NR 0 0.001CA NON-CASE INFO 0 NR NR NR NR 0 0.001CA OTHER OIL GAS 0 NR NR NR NR 0 0.001CA PROD WATER PONDS 0 NR NR NR NR 0 0.001CA SAMPLING POINT 0 NR NR NR NR 0 0.001CA WELL STIM PROJ 1 NR NR NR NR NR TP 1CA HWTS 0 NR NR NR NR 0 0.001MINES MRDS EDR HIGH RISK HISTORICAL RECORDS EDR Exclusive Records 0 NR 0 0 0 0 1.000EDR MGP 3 NR NR NR NR 3 0.125EDR Hist Auto 0 NR NR NR NR 0 0.125EDR Hist Cleaner EDR RECOVERED GOVERNMENT ARCHIVES Exclusive Recovered Govt. Archives 0 NR NR NR NR 0 0.001CA RGA LF TC06852412.2r Page 7 MAP FINDINGS SUMMARY Search TargetDistance Total Database Property(Miles) < 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1 > 1 Plotted 0 NR NR NR NR 0 0.001CA RGA LUST 181 0 17 35 60 64 5- Totals -- NOTES: TP = Target Property NR = Not Requested at this Search Distance Sites may be listed in more than one database TC06852412.2r Page 8 TC06852412.2r Page 9 A5 CA HAULERSGREAT DANE LIMITED PARTNERSHIP S127781180 Target 14387 VALLEY BLVD N/A Property FONTANA, CA Actual: 1035 ft. Click here for full text details CA HAULERS Facility ID 1052519 A4 ECHOGREAT DANE TRAILERS 1026136447 Target 14387 VALLEY BLVD N/A Property FONTANA, CA 92335 Actual: 1035 ft. Click here for full text details ECHO Registry ID 110070725060 A3 CA HWTSGREAT DANE TRAILERS S126371387 Target 14387 VALLEY BLVD N/A Property FONTANA, CA 92335 Actual: 1035 ft. Click here for full text details A2 FINDSGREAT DANE TRAILERS 1026413989 Target 14387 VALLEY BLVD N/A Property FONTANA, CA 92335 Actual: 1035 ft. Click here for full text details A1 RCRA NonGen / NLRGREAT DANE TRAILERS 1026048192 Target 14387 VALLEY BLVD CAC003054798 Property FONTANA, CA 92335 Actual: 1035 ft. Click here for full text details RCRA NonGen / NLR EPA Id CAC003054798 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 10 B9 RCRA NonGen / NLRSCHNEIDER NATIONAL, INC 1000886231 NNE FINDS14392 VALLEY BLVD CA0000133868 < 1/8 ECHOFONTANA, CA 92335 Relative: Higher Click here for full text details 0.026 mi.CA NPDES 139 ft.CA CIWQS RCRA NonGen / NLR EPA Id CA0000133868 FINDS Registry ID: 110002613565 ECHO Registry ID 110002613565 B8 RCRA NonGen / NLRKNIGHT-SWIFT TRANSPORTATION 1026801481 NNE 14392 VALLEY BLVD.CAC003113430 < 1/8 JURUPA VALLEY, CA 92335 Relative: Higher Click here for full text details 0.026 mi. 139 ft. B7 CA NPDESTRANS WEST TRUCK CENTER S111293028 CA CIWQS14435 VALLEY BOULEVARD N/A < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 1 ft. B6 FINDSTRANS WEST TRUCK CENTER 1023695424 ECHO14435 VALLEY BOULEVARD N/A < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 1 ft. FINDS Registry ID: 110070092494 ECHO Registry ID 110070092494 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 11 B13 RCRA NonGen / NLRKNIGHT-SWIFT TRANSPORTATION 1026800595 NNE 14392 VALLEY BLVD.CAC003112491 < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.026 mi. 139 ft. B12 CA ASTSWIFT TRANSPORTATION CO. OF ARIZONA, LLC U003776739 NNE CA CERS HAZ WASTE14392 VALLEY BLVD N/A < 1/8 CA CERS TANKSFONTANA, CA 92335 Relative: Higher Click here for full text details 0.026 mi.CA CHMIRS 139 ft.CA San Bern. Co. Permit CA WDS CA CERS CA CHMIRS OES Incident Number 4-5019 OES Incident Number 13-2506 CA San Bern. Co. Permit Facility Id FA0006070 Facility Status ACTIVE Facility Status INACTIVE CA WDS Facility Id 8 36I016467 Facility Status Active - Any facility with a continuous or seasonal discharge that is under Waste Discharge Requirements. B11 RCRA NonGen / NLRSWIFT TRANSPORTATION 1024856168 NNE 14392 VALLEY BLVD CAL000419760 < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.026 mi. 139 ft. RCRA NonGen / NLR EPA Id CAL000419760 B10 CA USTSWIFT TRANSPORTATION CO. OF ARIZONA, LLC U004353038 NNE 14392 VALLEY BLVD N/A < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.026 mi. 139 ft. CA UST Facility Id FA0006070 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 12 E18 CA USTFONTANA CHEVRON U004263727 ENE 14455 VALLEY BLVD N/A < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.086 mi. 453 ft. CA UST Facility Id FA0003253 D17 CA San Bern. Co. PermitRESTAURANT,FONTANA S109598479 NE CA CERS14454 VALLEY BLVD. N/A < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.074 mi. 393 ft. CA San Bern. Co. Permit Facility Id FA0012459 Facility Status INACTIVE C16 RCRA NonGen / NLRRUSH TRUCK CENTERS - FONTANA USED TRUCKS 1024854728 NW 14315 VALLEY BLVD CAL000416240 < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.027 mi. 140 ft. RCRA NonGen / NLR EPA Id CAL000416240 C15 CA CERS HAZ WASTERUSH TRUCK CENTERS - USED TRUCK SALES S118839899 NW CA HAZNET14315 VALLEY BLVD N/A < 1/8 CA San Bern. Co. PermitFONTANA, CA 92335 Relative: Higher Click here for full text details 0.027 mi.CA CERS 140 ft.CA HWTS CA HAZNET GEPAID CAL000416240 GEPAID CAC002854638 CA San Bern. Co. Permit Facility Id FA0016890 Facility Status ACTIVE B14 CA USTSCHNEIDER NATIONAL, INC U004343884 NNE 14392 VALLEY BLVD N/A < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.026 mi. 139 ft. CA UST Facility Id 1049296 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 13 F23 CA HIST USTYRC LOGISTICS (744-L)U001574825 SW CA San Bern. Co. Permit10268 ALMOND ST N/A < 1/8 FONTANA, CA 92335 Relative: Lower Click here for full text details 0.098 mi. 518 ft. CA HIST UST Facility Id 00000065963 CA San Bern. Co. Permit E22 EDR Hist AutoFONTANA CHEVRON CA236 1021548033 ENE 14455 VALLEY BLVD N/A < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.086 mi. 453 ft. E21 RCRA NonGen / NLRFONTANA CHEVRON 1024821064 ENE 14455 VALLEY BLVD CAL000335857 < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.086 mi. 453 ft. RCRA NonGen / NLR EPA Id CAL000335857 E20 CA ENFFONTANA CHEVRON S105047706 ENE CA San Bern. Co. Permit14455 VALLEY BLVD N/A < 1/8 CA CIWQSFONTANA, CA 92335 Relative: Higher Click here for full text details 0.086 mi.CA CERS 453 ft. CA ENF Facility Id 266588 Status Historical CA San Bern. Co. Permit Facility Id FA0003253 Facility Status ACTIVE E19 CA CERS HAZ WASTEFONTANA CHEVRON S113153768 ENE CA CERS TANKS14455 VALLEY BLVD N/A < 1/8 CA HAZNETFONTANA, CA 92335 Relative: Higher Click here for full text details 0.086 mi.CA CERS 453 ft.CA HWTS CA HAZNET GEPAID CAL000335857 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 14 F26 CA CERS HAZ WASTEFONTANA- NATIONAL RETAIL TRANSPORTATION S120765527 SW CA NPDES10268 ALMOND AVE N/A < 1/8 CA San Bern. Co. PermitFONTANA, CA 92335 Relative: Lower Click here for full text details 0.098 mi.CA CERS 518 ft. CA San Bern. Co. Permit Facility Id FA0017377 Facility Status ACTIVE Facility Status INACTIVE F25 CA SWEEPS USTCARRETTA TRUCKING, INC.S101619251 SW CA FID UST10268 ALMOND AVE N/A < 1/8 CA NPDESFONTANA, CA 92335 Relative: Lower Click here for full text details 0.098 mi.CA CIWQS 518 ft.CA CERS CA SWEEPS UST Status A Tank Status A Comp Number 65963 CA FID UST Facility Id 36002938 Status A CA NPDES Facility Status Active F24 RCRA NonGen / NLRNATIONAL RETAIL TRANSPORTATION INC 1024867694 SW 10268 ALMOND AVE CAL000436290 < 1/8 FONTANA, CA 92335 Relative: Lower Click here for full text details 0.098 mi. 518 ft. RCRA NonGen / NLR EPA Id CAL000436290 YRC LOGISTICS (744-L) (Continued) U001574825 Facility Id FA0011171 Facility Status INACTIVE MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 15 G29 CA LUSTFLEETCREW S108746742 NW CA AST14264 VALLEY BLVD N/A < 1/8 CA CERS HAZ WASTEFONTANA, CA 92607 Relative: Higher Click here for full text details 0.100 mi.CA CERS TANKS 527 ft.CA Cortese CA HAZNET CA San Bern. Co. Permit CA CERS CA HWTS CA LUST Status Completed - Case Closed Global Id T0607111670 CA Cortese Cleanup Status COMPLETED - CASE CLOSED CA HAZNET GEPAID CAL000416674 CA San Bern. Co. Permit Facility Id FA0013211 Facility Id FA0001593 Facility Id FA0010879 Facility Status ACTIVE Facility Status INACTIVE G28 EDR Hist AutoFONTANA TRUCK STOP CENTER 1022194262 NW 14264 VALLEY BLVD N/A < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.100 mi. 527 ft. G27 RCRA NonGen / NLRFONTANA TRUCK STOP CENTER 1024830937 NW 14264 VALLEY BLVD CAL000366717 < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.100 mi. 527 ft. RCRA NonGen / NLR EPA Id CAL000366717 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 16 D33 RCRA-SQGTIME OUT L L C D B A AM PM 11 1006805158 NE FINDS10062 CHERRY AVE CAR000124107 < 1/8 ECHOFONTANA, CA 92335 Relative: Higher Click here for full text details 0.102 mi.CA HAZNET 537 ft.CA HWTS RCRA-SQG EPA Id CAR000124107 FINDS Registry ID: 110013309393 ECHO Registry ID 110013309393 CA HAZNET GEPAID CAR000124107 G32 RCRA NonGen / NLRANELLE MANAGEMENT SERVICES INC DBA FLEET CREW 1024854894 NW 14264 VALLEY BLVD CAL000416674 < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.100 mi. 527 ft. RCRA NonGen / NLR EPA Id CAL000416674 G31 CA USTFONTANA TRUCK STOP CENTER LLC U004263577 NW 14264 VALLEY BLVD N/A < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.100 mi. 527 ft. CA UST Facility Id FA0001593 G30 CA HAZNETIRONMAN RENEWAL DBA ZIPPY LUBE-A-TRUCK S113146230 NW CA San Bern. Co. Permit14264 VALLEY BLVD N/A < 1/8 CA HWTSFONTANA, CA 92335 Relative: Higher Click here for full text details 0.100 mi. 527 ft. CA HAZNET GEPAID CAL000316225 CA San Bern. Co. Permit Facility Id FA0017031 Facility Status ACTIVE MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 17 H36 RCRA NonGen / NLRTRANS WEST FORD 1024824166 East 10150 CHERRY AVE CAL000346556 < 1/8 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.107 mi. 567 ft. RCRA NonGen / NLR EPA Id CAL000346556 H35 CA CERS HAZ WASTETRANS WEST FORD TRUCK 1000319643 East CA SWEEPS UST10150 CHERRY ST N/A < 1/8 CA HIST USTFONTANA, CA 92335 Relative: Higher Click here for full text details 0.107 mi.CA FID UST 567 ft.CA San Bern. Co. Permit CA CERS CA SWEEPS UST Status A Tank Status A Comp Number 67785 CA HIST UST Facility Id 00000067785 CA FID UST Facility Id 36004792 Status A CA San Bern. Co. Permit Facility Id FA0006773 Facility Status ACTIVE Facility Status INACTIVE D34 CA USTARCO AM/PM U003785465 NE CA CERS HAZ WASTE10062 CHERRY AVE N/A < 1/8 CA CERS TANKSFONTANA, CA 92335 Relative: Higher Click here for full text details 0.102 mi.CA San Bern. Co. Permit 537 ft.CA CERS CA UST Facility Id FA0001041 CA San Bern. Co. Permit Facility Id FA0001041 Facility Status ACTIVE MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 18 I40 CA HIST USTTRUCK TOWN AND TRUCK ADERO S112864685 SE CA HAZNET10238 CHERRY AVE N/A < 1/8 CA HWTSFONTANA, CA 92335 Relative: Lower Click here for full text details 0.108 mi. 570 ft. CA HAZNET GEPAID CAC001066336 I39 CA FID USTTRUCK TOWN S101619284 SE CA HIST CORTESE10238 N/A < 1/8 FONTANA, CA 92355 Relative: Lower Click here for full text details 0.108 mi. 570 ft. CA FID UST Facility Id 36002369 Status A CA HIST CORTESE Reg Id 083603062T I38 CA HIST USTTRUCK TOWN U001574910 SE CA San Bern. Co. Permit10238 CHERRY AVE N/A < 1/8 FONANA, CA 92335 Relative: Lower Click here for full text details 0.108 mi. 570 ft. CA HIST UST Facility Id 00000056226 CA San Bern. Co. Permit Facility Id FA0007402 Facility Status INACTIVE I37 CA CorteseTRUCK TOWN S113158366 SE CA HAZNET10238 CHERRY AVE N/A < 1/8 CA HWTSFONTANA, CA 92355 Relative: Lower Click here for full text details 0.108 mi. 570 ft. CA Cortese Cleanup Status COMPLETED - CASE CLOSED CA HAZNET GEPAID CAL000351499 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 19 I44 RCRA-SQGA F TIRE SERVICE 1000595476 ESE FINDS10283 CHERRY AVE CAD983594136 1/8-1/4 ECHOFONTANA, CA 92335 Relative: Higher Click here for full text details 0.140 mi. 738 ft. RCRA-SQG EPA Id CAD983594136 FINDS Registry ID: 110002852306 ECHO I43 CA LUSTTRUCK TOWN S102039455 SE CA SWEEPS UST10238 CHERRY AVE N/A < 1/8 CA San Bern. Co. PermitFONTANA, CA 92355 Relative: Lower Click here for full text details 0.108 mi.CA CERS 570 ft. CA LUST Global ID T0607100455 Facility Status Preliminary site assessment workplan submitted Status Completed - Case Closed Global Id T0607100455 CA SWEEPS UST Status A Tank Status A Comp Number 56226 CA San Bern. Co. Permit Facility Id FA0006812 Facility Status INACTIVE I42 CA USTTRUCK TOWN & TRUCKADERO U003942517 SE 10238 CHERRY AVE N/A < 1/8 FONTANA, CA 92335 Relative: Lower Click here for full text details 0.108 mi. 570 ft. CA UST Facility Id FA0006812 I41 EDR Hist AutoFULLRICH DEVELOPMENT CORP 1020851544 SE 10238 CHERRY AVE N/A < 1/8 FONTANA, CA 92335 Relative: Lower Click here for full text details 0.108 mi. 570 ft. MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 20 J48 CA HAULERSPETE’S ROAD SERVICE INC S113097263 West CA CERS HAZ WASTE14239 VALLEY BLVD N/A 1/8-1/4 CA HAZNETFONTANA, CA 92335 Relative: Lower Click here for full text details 0.143 mi.CA San Bern. Co. Permit 756 ft.CA CERS CA HWTS CA HAULERS Facility ID 1222054 CA HAZNET GEPAID CAL000183331 CA San Bern. Co. Permit Facility Id FA0016599 Facility Status ACTIVE J47 RCRA NonGen / NLRPETE’S ROAD SERVICE INC 1024797253 West 14239 VALLEY BLVD CAL000183331 1/8-1/4 FONTANA, CA 92335 Relative: Lower Click here for full text details 0.143 mi. 756 ft. RCRA NonGen / NLR EPA Id CAL000183331 H46 RCRA NonGen / NLRARROW TRUCK SALES INC 1024860991 ESE 10175 CHERRY AVE CAL000429451 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.141 mi. 742 ft. RCRA NonGen / NLR EPA Id CAL000429451 H45 CA CERS HAZ WASTEARROW TRUCK SALES, INC. - FONTANA BRANCH S114401464 ESE CA San Bern. Co. Permit10175 CHERRY AVE N/A 1/8-1/4 CA CERSFONTANA, CA 92335 Relative: Higher Click here for full text details 0.141 mi. 742 ft. CA San Bern. Co. Permit Facility Id FA0015139 Facility Status ACTIVE A F TIRE SERVICE (Continued)1000595476 Registry ID 110002852306 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 21 K53 CA LUSTMOBIL STATION S102039278 ENE CA SWEEPS UST14518 VALLEY BLVD N/A 1/8-1/4 CA CorteseFONTANA, CA 92335 Relative: Higher Click here for full text details 0.147 mi.CA HIST CORTESE 775 ft.CA CERS CA LUST Global ID T0607100245 K52 CA HIST USTABRAHAM RIDA U001560693 ENE 14518 VALLEY BLVD N/A 1/8-1/4 FONTANA, CA 90017 Relative: Higher Click here for full text details 0.147 mi. 775 ft. CA HIST UST Facility Id 00000039217 K51 RCRA NonGen / NLRFONTANA CV MARKET, INC.1026467115 ENE 14518 VALLEY BLVD CAC003072446 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.147 mi. 775 ft. K50 CA CERS HAZ WASTEFONTANA CV MARKET, INC.S101590969 ENE CA CERS TANKS14518 VALLEY BLVD N/A 1/8-1/4 CA FID USTFONTANA, CA 92335 Relative: Higher Click here for full text details 0.147 mi.CA San Bern. Co. Permit 775 ft.CA CERS CA HWTS CA FID UST Facility Id 36000395 Status A CA San Bern. Co. Permit Facility Id FA0006288 Facility Status ACTIVE Facility Status INACTIVE K49 CA USTFONTANA CV MARKET, INC. (DBA: ONE STOP MARKET) U004353086 ENE 14518 VALLEY BLVD N/A 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.147 mi. 775 ft. CA UST Facility Id FA0006288 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 22 J56 RCRA NonGen / NLRACTION AUC DISPOSAL CO 1000259551 WNW FINDS14226 1/2 VALLEY BLVD CAD982515827 1/8-1/4 ECHOFONTANA, CA 92335 Relative: Higher Click here for full text details 0.155 mi. 820 ft. RCRA NonGen / NLR EPA Id CAD982515827 FINDS Registry ID: 110008280396 G55 CA San Bern. Co. PermitCLEAN ENERGY - 13695 S117896899 WNW CA CERS14230 VALLEY BLVD N/A 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.150 mi. 792 ft. CA San Bern. Co. Permit Facility Id FA0015983 Facility Status ACTIVE K54 CA USTSON’S MOBIL STATION U004350368 ENE 14518 VALLEY BLVD N/A 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.147 mi. 775 ft. CA UST Facility Id 86008794 MOBIL STATION (Continued)S102039278 Facility Status Case Closed Status Completed - Case Closed Status Open - Assessment & Interim Remedial Action Global Id T0607100245 Global Id T10000007267 CA SWEEPS UST Status A Tank Status A Comp Number 39217 CA Cortese Cleanup Status OPEN - ASSESSMENT & INTERIM REMEDIAL ACTION Cleanup Status COMPLETED - CASE CLOSED CA HIST CORTESE Reg Id 083602008T MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 23 L60 CA SWEEPS USTKEHR, DOUG S106928107 NNW 10002 ALMONT B N/A 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.162 mi. 854 ft. CA SWEEPS UST Status A Tank Status A Comp Number 8793 L59 CA SWEEPS USTLAMPKINS, MARK S101591097 NNW CA FID UST10002 ALMOND N/A 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.162 mi. 854 ft. CA SWEEPS UST Status A Tank Status A Comp Number 63340 CA FID UST Facility Id 36001418 Status A L58 CA FID USTKEHR, DOUG S101591591 NNW 10002 ALMONT N/A 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.162 mi. 854 ft. CA FID UST Facility Id 36008465 Status A J57 TX Ind. Haz WasteFINDLY CHEMICAL DISPOSAL S105478463 WNW 14226 1/2 VALLEY BLVD N/A 1/8-1/4 FONTANA, TX 92335 Relative: Higher Click here for full text details 0.155 mi. 820 ft. TX Ind. Haz Waste Registration Number 41014 ACTION AUC DISPOSAL CO (Continued) 1000259551 ECHO Registry ID 110008280396 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 24 M64 CA San Bern. Co. PermitC & M STEEL S110071655 SW 10312 ALMOND AVE N/A 1/8-1/4 FONTANA, CA 92335 Relative: Lower Click here for full text details 0.188 mi. 991 ft. CA San Bern. Co. Permit Facility Id FA0001639 Facility Status INACTIVE M63 CA CERS HAZ WASTEFLEET SERVICES GROUP LLC S105048150 SW CA NPDES10312 ALMOND AVE N/A 1/8-1/4 CA San Bern. Co. PermitFONTANA, CA 92335 Relative: Lower Click here for full text details 0.188 mi.CA WDS 991 ft.CA CIWQS CA CERS CA HWTS CA San Bern. Co. Permit Facility Id FA0017280 Facility Id FA0012839 Facility Status ACTIVE Facility Status INACTIVE CA WDS Facility Id 8 36I016875 Facility Status Active - Any facility with a continuous or seasonal discharge that is under Waste Discharge Requirements. L62 CA LUSTBTE FUEL STOP U003785222 NNW CA UST10002 ALMOND AVE N/A 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.162 mi. 854 ft. CA LUST Global ID T0607111670 Facility Status Pollution Characterization CA UST Facility Id 90023017 L61 CA HIST USTACTION TRUCKING U001574813 NNW 10002 ALMOND N/A 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.162 mi. 854 ft. CA HIST UST Facility Id 00000063340 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 25 L67 CA HIST USTUPLAND FREIGHT LINES INC.U001574915 NNW 9993 ALMOND AVE N/A 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.189 mi. 998 ft. CA HIST UST Facility Id 00000046352 L66 RCRA-SQGMORGAN CORP 1000232651 NNW CA SWEEPS UST9993 ALMOND AVE CAD982011736 1/8-1/4 CA HIST USTFONTANA, CA 92335 Relative: Higher Click here for full text details 0.189 mi.CA FID UST 998 ft.FINDS ECHO CA HAZNET CA HWTS RCRA-SQG EPA Id CAD982011736 CA SWEEPS UST Status A Tank Status A Comp Number 46352 CA FID UST Facility Id 36003799 Status A FINDS Registry ID: 110002775854 ECHO Registry ID 110002775854 CA HAZNET GEPAID CAD982011736 N65 CA San Bern. Co. PermitEMPIRE SPEEDO & TACH S104766046 NE 9996 CHERRY AVE N/A 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.188 mi. 991 ft. CA San Bern. Co. Permit Facility Id FA0002915 Facility Status INACTIVE MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 26 N72 CA SWEEPS USTCARRIER TRANSICOLD OF SOUTHERN CALIFORNIA S101591032 NE CA FID UST9979 CHERRY AVE N/A 1/8-1/4 CA HAZNETFONTANA, CA 92335 Relative: Higher Click here for full text details 0.213 mi.CA San Bern. Co. Permit 1125 ft.CA HWTS CA SWEEPS UST Status A Tank Status A Comp Number 11263 CA FID UST N71 RCRA NonGen / NLRCARRIER TRANSICOLD OF SOUTHERN CALIFORNIA 1024852485 NE 9979 CHERRY AVE CAL000411670 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.213 mi. 1125 ft. RCRA NonGen / NLR EPA Id CAL000411670 O70 CA CERS HAZ WASTEAT&T MOBILITY - (USID127429)S118648384 ESE CA San Bern. Co. Permit14560 WASHINGTON DR N/A 1/8-1/4 CA CERSFONTANA, CA 92335 Relative: Higher Click here for full text details 0.202 mi. 1064 ft. CA San Bern. Co. Permit Facility Id FA0016722 Facility Status ACTIVE O69 RCRA NonGen / NLRAT&T MOBILITY 1024857914 ESE 14560 WASHINGTON ST CAL000423552 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.202 mi. 1064 ft. RCRA NonGen / NLR EPA Id CAL000423552 N68 CA CERS HAZ WASTERENE’S TIRE SERVICE S104771134 NE CA San Bern. Co. Permit10007 CHERRY AVE N/A 1/8-1/4 CA CERSFONTANA, CA 92335 Relative: Higher Click here for full text details 0.192 mi. 1014 ft. CA San Bern. Co. Permit Facility Id FA0011289 Facility Id FA0006694 Facility Status ACTIVE Facility Status INACTIVE MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 27 P75 CA HAZNETBIG RIG TRUCK REPAIRING,INC.S113464879 ENE CA San Bern. Co. Permit14578 VALLEY BLVD N/A 1/8-1/4 CA HWTSFONTANA, CA 92335 Relative: Higher Click here for full text details 0.219 mi. 1155 ft. CA HAZNET GEPAID CAD982347940 CA San Bern. Co. Permit Facility Id FA0001468 Facility Status INACTIVE P74 RCRA-SQGBIG RIG TRUCK REPAIR 1000129966 ENE FINDS14578 VALLEY BLVD CAD982347940 1/8-1/4 ECHOFONTANA, CA 92335 Relative: Higher Click here for full text details 0.219 mi. 1155 ft. RCRA-SQG EPA Id CAD982347940 FINDS Registry ID: 110002798269 ECHO Registry ID 110002798269 73 CA San Bern. Co. PermitTOM’S TRUCK REPAIR S104771163 NE 14546 HUNTER AVE N/A 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.216 mi. 1140 ft. CA San Bern. Co. Permit Facility Id FA0006708 Facility Status INACTIVE CARRIER TRANSICOLD OF SOUTHERN CALIFORNIA (Continued) S101591032 Facility Id 36000921 Status A CA HAZNET GEPAID CAL000411670 CA San Bern. Co. Permit Facility Id FA0011789 Facility Status INACTIVE MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 28 O79 CA San Bern. Co. PermitBOYCE FOREST PRODUCTS INC S104764350 ESE 14570 WASHINGTON DR N/A 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.224 mi. 1182 ft. CA San Bern. Co. Permit Facility Id FA0001546 Facility Status INACTIVE Q78 CA CERS HAZ WASTECARGO SOLUTION EXPRESS INC S108744122 East CA CERS TANKS14587 VALLEY BLVD N/A 1/8-1/4 CA NPDESFONTANA, CA 92335 Relative: Higher Click here for full text details 0.222 mi.CA San Bern. Co. Permit 1174 ft.CA CIWQS CA CERS CA NPDES Facility Status Active CA San Bern. Co. Permit Facility Id FA0013904 Facility Status ACTIVE Facility Status FEE EXEMPT Facility Status INACTIVE Q77 RCRA NonGen / NLRCARGO SOLUTION EXPRESS INC 1025866983 East 14587 VALLEY BLVD CAL000286022 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.222 mi. 1174 ft. RCRA NonGen / NLR EPA Id CAL000286022 Q76 RCRA NonGen / NLRCONTINENTAL DPF RADIATORS 1025869875 East 14589 VALLEY BLVD CAL000417770 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.222 mi. 1173 ft. RCRA NonGen / NLR EPA Id CAL000417770 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 29 R84 CA LUSTBURRTEC WASTE INDUSTRIES S102425930 NNE CA Cortese9950 CHERRY AVE N/A 1/4-1/2 CA HIST CORTESEFONTANA, CA 92335 Relative: Higher Click here for full text details 0.288 mi.CA CERS 1522 ft. CA LUST Global ID T0607100405 Facility Status Case Closed Status Completed - Case Closed Global Id T0607100405 CA Cortese R83 CA LOS ANGELES CO LF METHANEBURRTEC WASTE INDUSTRIES, INC. - FONTANA S127128127 NNE N/A 1/4-1/2 , CA Relative: Higher Click here for full text details 0.255 mi. 1348 ft. 82 RCRA NonGen / NLRTEC EQUIPMENT, INC.1024775779 WNW 14166 VALLEY BLVD CAC002995711 1/8-1/4 FONTANA, CA 92335 Relative: Lower Click here for full text details 0.242 mi. 1278 ft. RCRA NonGen / NLR EPA Id CAC002995711 P81 CA CERS HAZ WASTECONTINENTAL DPF SERVICE S122218680 ENE CA San Bern. Co. Permit14601 VALLEY BLVD N/A 1/8-1/4 CA CERSFONTANA, CA 92335 Relative: Higher Click here for full text details 0.235 mi. 1239 ft. CA San Bern. Co. Permit Facility Id FA0017746 Facility Status ACTIVE N80 SEMS-ARCHIVEBANANA STREET PIT 1003877946 NE 9900 BLOCK OF BANANA ST CAD983566696 1/8-1/4 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.234 mi. 1234 ft. SEMS-ARCHIVE Site ID 0900016 EPA Id CAD983566696 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 30 S85 CA SWF/LFRANCHO DISPOSAL INC 1000171017 NNE CA LUST9890 CHERRY AVE N/A 1/4-1/2 CA USTFONTANA, CA 92335 Relative: Higher Click here for full text details 0.321 mi.CA HAULERS 1694 ft.CA SWEEPS UST CA HIST UST CA FID UST CA Cortese CA ENF CA HIST CORTESE CA NPDES CA San Bern. Co. Permit CA WDS CA CIWQS CA CERS CA SWF/LF Status Active Site ID 229 CA LUST Global ID T0607100120 Facility Status Case Closed Status Completed - Case Closed Global Id T0607100120 Global Id T0607184831 CA UST Facility Id 85007489 CA HAULERS Facility ID 1001726 CA SWEEPS UST Status A Tank Status A Comp Number 6635 CA HIST UST Facility Id 00000006635 CA FID UST Facility Id 36002653 Status A BURRTEC WASTE INDUSTRIES (Continued) S102425930 Cleanup Status COMPLETED - CASE CLOSED CA HIST CORTESE Reg Id 083602791T MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 31 T87 CA LUSTPIPELINE TRUCKING COMPANY S101591313 North CA SWEEPS UST9813 ALMOND AVE N/A 1/4-1/2 CA FID USTFONTANA, CA 92335 Relative: Higher Click here for full text details 0.329 mi.CA Cortese 1737 ft.CA HAZNET CA HIST CORTESE CA CERS CA LUST Global ID T0607100609 Facility Status Case Closed CA SWEEPS UST Status A Tank Status A Comp Number 54953 S86 CA LOS ANGELES CO LF METHANERANCHO DISPOSAL SERVICE S127128280 NNE N/A 1/4-1/2 , CA Relative: Higher Click here for full text details 0.325 mi. 1715 ft. RANCHO DISPOSAL INC (Continued) 1000171017 CA Cortese Cleanup Status COMPLETED - CASE CLOSED CA ENF Status Historical Facility Id 266597 Status Historical CA HIST CORTESE Reg Id 083601088T CA NPDES Facility Status Active CA San Bern. Co. Permit Facility Id FA0016017 Facility Status ACTIVE CA WDS Facility Id 8 36I000268 Facility Status Active - Any facility with a continuous or seasonal discharge that is under Waste Discharge Requirements. MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 32 U89 RCRA-SQGSWIFT TRANSPORTATION 1001967633 NW CA LUST9951 BANANA AVE CAR000071373 1/4-1/2 FINDSFONTANA, CA 92335 Relative: Higher Click here for full text details 0.357 mi.ECHO 1885 ft.CA Cortese CA HAZNET CA NPDES CA San Bern. Co. Permit CA WDS CA CIWQS CA CERS CA HWTS RCRA-SQG EPA Id CAR000071373 CA LUST Status Open - Site Assessment Status Completed - Case Closed Global Id T10000012395 T88 CA LUSTPIPELINE TRUCKING COMPANY S104405135 North CA San Bern. Co. Permit9813 ALMOND AVE N/A 1/4-1/2 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.329 mi. 1737 ft. CA LUST Status Completed - Case Closed Global Id T0607100609 CA San Bern. Co. Permit Facility Id FA0005333 Facility Status INACTIVE PIPELINE TRUCKING COMPANY (Continued) S101591313 CA FID UST Facility Id 36004445 Status A CA Cortese Cleanup Status COMPLETED - CASE CLOSED CA HAZNET GEPAID CAC002979834 CA HIST CORTESE Reg Id 083603581T MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 33 V91 CA LUSTTRANS-WEST CARRIERS S102439203 South CA Cortese14396 SLOVER AVE N/A 1/4-1/2 CA HIST CORTESEFONTANA, CA 92335 Relative: Lower Click here for full text details 0.363 mi.CA CERS 1915 ft. CA LUST Global ID T0607100370 U90 CA LUSTSWIFT TRANSPORTATION S104770862 NW CA Cortese9951 BANANA ST N/A 1/4-1/2 CA HIST CORTESEFONTANA, CA 92335 Relative: Higher Click here for full text details 0.357 mi. 1885 ft. CA LUST Global ID T0607100570 Facility Status Preliminary site assessment workplan submitted CA Cortese Cleanup Status COMPLETED - CASE CLOSED CA HIST CORTESE Reg Id 083603442T SWIFT TRANSPORTATION (Continued) 1001967633 Global Id T0607100570 FINDS Registry ID: 110002935860 ECHO Registry ID 110002935860 CA Cortese Cleanup Status OPEN - SITE ASSESSMENT CA HAZNET GEPAID CAR000071373 CA San Bern. Co. Permit Facility Id FA0006562 Facility Status INACTIVE CA WDS Facility Id 8 36I018295 Facility Status Active - Any facility with a continuous or seasonal discharge that is under Waste Discharge Requirements. MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 34 V92 RCRA-SQGLEND LEASE FACILITY 1000183437 South CA LUST14 416 SLOVER CAD981445760 1/4-1/2 CA CERS HAZ WASTEFONTANA, CA 92335 Relative: Lower Click here for full text details 0.370 mi.CA SWEEPS UST 1953 ft.CA HIST UST CA CERS TANKS CA FID UST FINDS ECHO CA Cortese CA HIST CORTESE CA San Bern. Co. Permit CA CERS CA HWTS RCRA-SQG EPA Id CAD981445760 CA LUST Global ID T0607100026 Facility Status Pollution Characterization Status Completed - Case Closed Global Id T0607100026 CA SWEEPS UST Status A Tank Status A Comp Number 48868 CA HIST UST Facility Id 00000048868 CA FID UST Facility Id 36000245 Status A FINDS Registry ID: 110002709613 ECHO TRANS-WEST CARRIERS (Continued) S102439203 Facility Status Case Closed Status Completed - Case Closed Global Id T0607100370 CA Cortese Cleanup Status COMPLETED - CASE CLOSED CA HIST CORTESE Reg Id 083602631T MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 35 W94 RCRA-SQGNORTH AMERICAN VAN LINES 1000404824 SSW CA LUST14320 SLOVER AVENUE CAD982516262 1/4-1/2 CA SWEEPS USTFONTANA, CA 92335 Relative: Lower Click here for full text details 0.371 mi.CA FID UST 1958 ft.CA CHMIRS CA Cortese CA HIST CORTESE CA NPDES CA WDS CA CIWQS CA HWTS RCRA-SQG EPA Id CAD982516262 CA LUST Global ID T0607100556 Facility Status Case Closed CA SWEEPS UST Status A Tank Status A W93 CA LUSTFLEET SERVICE OF LOS ANGELES U001574838 SSW CA HIST UST14320 SLOVER AVE N/A 1/4-1/2 CA CERSFONTANA, CA 92335 Relative: Lower Click here for full text details 0.371 mi. 1958 ft. CA LUST Status Completed - Case Closed Global Id T0607100556 CA HIST UST Facility Id 00000053640 LEND LEASE FACILITY (Continued)1000183437 Registry ID 110002709613 CA Cortese Cleanup Status COMPLETED - CASE CLOSED CA HIST CORTESE Reg Id 083600225T CA San Bern. Co. Permit Facility Id FA0007419 Facility Status ACTIVE Facility Status INACTIVE MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 36 96 RCRA-SQGCIRCLE K STORE #514 1000174028 SSE CA LUST14527 SLOVER ST CAD981679954 1/4-1/2 CA CERS HAZ WASTEFONTANA, CA 92335 Relative: Lower Click here for full text details 0.417 mi.CA SWEEPS UST 2204 ft.CA HIST UST CA CERS TANKS CA FID UST CA CHMIRS FINDS ECHO CA Cortese CA HAZNET CA HIST CORTESE CA San Bern. Co. Permit CA CERS CA HWTS RCRA-SQG 95 CA SWF/LFRANCHO DISPOSAL SERVICE S114674210 NNE CA RGA LUST9820 CHERRY AVE. N/A 1/4-1/2 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.380 mi. 2006 ft. CA SWF/LF Status Active Site ID 3626 NORTH AMERICAN VAN LINES (Continued) 1000404824 Comp Number 53640 CA FID UST Facility Id 36003094 Status A CA CHMIRS OES Incident Number 21-3110 CA Cortese Cleanup Status COMPLETED - CASE CLOSED CA HIST CORTESE Reg Id 083603402T CA NPDES Facility Status Terminated CA WDS Facility Id 8 36I003230 Facility Status Active - Any facility with a continuous or seasonal discharge that is under Waste Discharge Requirements. MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 37 CIRCLE K STORE #514 (Continued)1000174028 EPA Id CAD981679954 CA LUST Global ID T0607100535 Facility Status Remediation Plan Status Completed - Case Closed Global Id T0607100535 CA SWEEPS UST Status A Tank Status A Comp Number 13598 CA HIST UST Facility Id 00000013598 CA FID UST Facility Id 36003035 Status A CA CHMIRS OES Incident Number 8-0300 FINDS Registry ID: 110002749063 Registry ID: 110059789894 ECHO Registry ID 110002749063 CA Cortese Cleanup Status COMPLETED - CASE CLOSED CA HAZNET GEPAID CAL000406925 CA HIST CORTESE Reg Id 083603351T CA San Bern. Co. Permit Facility Id FA0002156 Facility Status ACTIVE MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 38 98 CA LUSTAZ FUEL STOP S101591589 NNE CA CERS HAZ WASTE14529 SAN BERNARDINO AVE N/A 1/4-1/2 CA SWEEPS USTFONTANA, CA 92335 Relative: Higher Click here for full text details 0.472 mi.CA FID UST 2493 ft.CA CERS TANKS CA Cortese CA HIST CORTESE CA CERS CA LUST Global ID T0607100635 Facility Status Case Closed Status Completed - Case Closed Global Id T0607100635 CA SWEEPS UST Status A Tank Status A Comp Number 8757 CA FID UST Facility Id 36008463 Status A CA Cortese 97 CA SWRCYECOLOGY AUTO PARTS S103630297 SSW CA CERS HAZ WASTE14187 SLOVER AVE N/A 1/4-1/2 CA CERS TANKSFONTANA, CA 92335 Relative: Lower Click here for full text details 0.439 mi.CA NPDES 2316 ft.CA San Bern. Co. Permit CA PROC CA WDS CA CIWQS CA CERS CA HWTS CA SWRCY Cert Id RC262590.001 CA NPDES Facility Status Active CA San Bern. Co. Permit Facility Id FA0014933 Facility Status ACTIVE Facility Status FEE EXEMPT CA WDS Facility Id 8 36I013226 Facility Status Active - Any facility with a continuous or seasonal discharge that is under Waste Discharge Requirements. MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 39 X100 CA RESPONSECALIFORNIA STEEL IND INC S105655975 NW CA ENVIROSTOR14000 SAN BERNARDINO AVE N/A 1/2-1 CA LUSTFONTANA, CA 92335 Relative: Higher Click here for full text details 0.681 mi.CA CERS HAZ WASTE 3595 ft.CA CERS TANKS CA CHMIRS CA ENF CA HWP CA NPDES CA San Bern. Co. Permit CA CIWQS CA CERS CA RESPONSE Facility Id 36330046 Status Active CA ENVIROSTOR Facility Id 71004125 Facility Id 36330046 X99 CA HIST Cal-SitesCALIFORNIA STEEL SUPPLY 1006826243 NW TSCA14000 SAN BERNARDINO AVE. N/A 1/2-1 ICISFONTANA, CA 92335 Relative: Higher Click here for full text details 0.681 mi.US AIRS 3595 ft.FINDS ECHO CA EMI ICIS FRS ID: 110063857376 FINDS Registry ID: 110065613508 Registry ID: 110063857376 Registry ID: 110013853044 ECHO Registry ID 110063857376 Registry ID 110013853044 CA EMI Facility Id 105583 Facility Id 66342 AZ FUEL STOP (Continued)S101591589 Cleanup Status COMPLETED - CASE CLOSED CA HIST CORTESE Reg Id 083603646T MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 40 101 CA ENVIROSTORCONSTRUCTION STEEL WORKS S105047779 SSE CA EMI10665 REDWOOD AVENUE N/A 1/2-1 CA HAZNETFONTANA, CA 92337 Relative: Lower Click here for full text details 0.710 mi.CA San Bern. Co. Permit 3747 ft.CA CERS CA HWTS CA ENVIROSTOR Facility Id 36340068 Status Refer: 1248 Local Agency CA EMI Facility Id 52534 CALIFORNIA STEEL IND INC (Continued) S105655975 Facility Id 71003628 Status Inactive - Needs Evaluation Status Active Status Refer: Other Agency CA LUST Status Completed - Case Closed Global Id T0607100014 CA CHMIRS OES Incident Number 8-2551 CA ENF Status Active Status Historical Facility Id 259067 Status Withdrawn Status Historical CA HWP EPA ID CAD118352921 Cleanup Status CLOSED CA NPDES Facility Status Active CA San Bern. Co. Permit Facility Id FA0001735 Facility Id FA0001559 Facility Id FA0011923 Facility Id FA0010112 Facility Id FA0008576 Facility Id FA0006668 Facility Status ACTIVE Facility Status INACTIVE MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 41 Y103 SEMS-ARCHIVEERICKSON INC 1000173605 WSW CORRACTS13738 SLOVER AVE CAD982484933 1/2-1 RCRA-SQGFONTANA, CA 92337 Relative: Lower Click here for full text details 0.870 mi.FINDS 4595 ft.ECHO CA HWP SEMS-ARCHIVE Site ID 0904221 EPA Id CAD982484933 CORRACTS EPA ID: CAD982484933 RCRA-SQG EPA Id CAD982484933 FINDS Registry ID: 110000887577 ECHO Registry ID 110000887577 CA HWP Y102 CA ENVIROSTORECOLOGY CONTROL INDUSTRY S103629387 WSW CA San Bern. Co. Permit13738 SLOVER AVE N/A 1/2-1 FONTANA, CA 92335 Relative: Lower Click here for full text details 0.870 mi. 4595 ft. CA ENVIROSTOR Facility Id 80001499 Status No Further Action CA San Bern. Co. Permit Facility Id FA0002935 Facility Status INACTIVE CONSTRUCTION STEEL WORKS (Continued) S105047779 CA HAZNET GEPAID CAC002905320 CA San Bern. Co. Permit Facility Id FA0002482 Facility Status INACTIVE MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 42 Z104 SEMS-ARCHIVEKAISER VENTURES, INC.1000840761 North CORRACTS13429 SAN BERNARDINO AVE CAD008274938 1/2-1 RCRA-TSDFFONTANA, CA 92334 Relative: Higher Click here for full text details 0.925 mi.US INST CONTROLS 4884 ft.RCRA NonGen / NLR US FIN ASSUR 2020 COR ACTION CONSENT FINDS ECHO CA HAZNET CA ICE CA HWP CA CERS CA HWTS SEMS-ARCHIVE Site ID 0903631 EPA Id CAD008274938 CORRACTS EPA ID: CAD008274938 RCRA-TSDF EPA Id CAD008274938 US INST CONTROLS EPA ID: CAD008274938 RCRA NonGen / NLR EPA Id CAD008274938 US FIN ASSUR EPA ID CAD008274938 2020 COR ACTION EPA ID: CAD008274938 FINDS Registry ID: 110000609226 ECHO Registry ID 110000609226 CA HAZNET ERICKSON INC (Continued)1000173605 EPA ID CAD982484933 Cleanup Status CLOSED MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 43 Z105 CA ENVIROSTORKAISER STEEL - TAR PITS AREA S101272834 North CA SWF/LF9400 CHERRY AVENUE N/A 1/2-1 CA CPS-SLICFONTANA, CA 92335 Relative: Higher Click here for full text details 0.925 mi.CA VCP 4884 ft.CA HIST Cal-Sites CA DEED CA HIST CORTESE CA ENVIROSTOR Facility Id 60001356 Facility Id 80001542 Status Active Status Certified / Operation & Maintenance CA SWF/LF Operational Status Closed Regulation Status Not Currently Regulated Facility ID 36-AA-0018 CA CPS-SLIC Facility Status Completed - Case Closed Global Id SLT8R1484121 Click here to access the California GeoTracker records for this facility CA VCP Facility Id 60001356 Status Active CA DEED Envirostor ID 80001542 Envirostor ID 60001356 Status CERTIFIED / OPERATION & MAINTENANCE Status ACTIVE CA HIST CORTESE Reg Id 36330009 Reg Id 36330047 Reg Id 36330048 Reg Id 36330049 KAISER VENTURES, INC. (Continued) 1000840761 GEPAID CAD008274938 CA HWP EPA ID CAD008274938 Cleanup Status POST CLOSURE PERMIT MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TC06852412.2r Page 44 Z108 CA HIST Cal-SitesKAISER STEEL - CHEMWEST AREA S101272832 North 9400 CHERRY AVENUE N/A 1/2-1 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.925 mi. 4884 ft. Z107 CA HIST Cal-SitesKAISER STEEL-EAST SLAG PILE/SEWAGE PLANT S100833424 North CA BOND EXP. PLAN9400 CHERRY AVENUE N/A 1/2-1 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.925 mi. 4884 ft. Z106 CA HIST Cal-SitesKAISER STEEL - BYPRODUCTS AREA S101272831 North 9400 CHERRY AVENUE N/A 1/2-1 FONTANA, CA 92335 Relative: Higher Click here for full text details 0.925 mi. 4884 ft. MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.CA AQUEOUS FOAM Former Fire Training Facility Assessments Listing State Water Resources Control Board 12/01/2019 08/19/2021 10/28/2021CA AST Aboveground Petroleum Storage Tank Facilities California Environmental Protection Agency 07/06/2016 07/12/2016 09/19/2016CA BROWNFIELDS Considered Brownfieds Sites Listing State Water Resources Control Board 09/20/2021 09/21/2021 12/08/2021CA CA BOND EXP. PLAN Bond Expenditure Plan Department of Health Services 01/01/1989 07/27/1994 08/02/1994CA CA FID UST Facility Inventory Database California Environmental Protection Agency 10/31/1994 09/05/1995 09/29/1995CA CDL Clandestine Drug Labs Department of Toxic Substances Control 12/31/2019 01/20/2021 04/08/2021CA CERS CalEPA Regulated Site Portal Data California Environmental Protection Agency 10/18/2021 10/19/2021 01/12/2022CA CERS HAZ WASTE CERS HAZ WASTE CalEPA 10/18/2021 10/19/2021 01/12/2022CA CERS TANKS California Environmental Reporting System (CERS) Tanks California Environmental Protection Agency 10/18/2021 10/19/2021 01/12/2022CA CHMIRS California Hazardous Material Incident Report System Office of Emergency Services 09/30/2021 10/19/2021 01/12/2022CA CIWQS California Integrated Water Quality System State Water Resources Control Board 08/30/2021 08/31/2021 11/19/2021CA CORTESE "Cortese" Hazardous Waste & Substances Sites List CAL EPA/Office of Emergency Information 09/20/2021 09/21/2021 12/08/2021CA CPS-SLIC Statewide SLIC Cases (GEOTRACKER) State Water Resources Control Board 09/07/2021 09/07/2021 11/29/2021CA CUPA LIVERMORE-PLEASANTON CUPA Facility Listing Livermore-Pleasanton Fire Department 05/01/2019 05/14/2019 07/17/2019CA DEED Deed Restriction Listing DTSC and SWRCB 08/30/2021 08/31/2021 11/19/2021CA DRYCLEAN AVAQMD Antelope Valley Air Quality Management District Drycleaner L Antelope Valley Air Quality Management Distri 08/24/2021 08/25/2021 11/17/2021CA DRYCLEAN SOUTH COAST South Coast Air Quality Management District Drycleaner Listi South Coast Air Quality Management District 11/17/2021 11/18/2021 02/07/2022CA DRYCLEANERS Cleaner Facilities Department of Toxic Substance Control 08/27/2021 09/01/2021 11/19/2021CA EMI Emissions Inventory Data California Air Resources Board 12/31/2019 06/10/2021 08/27/2021CA ENF Enforcement Action Listing State Water Resoruces Control Board 11/10/2021 11/11/2021 02/03/2022CA ENVIROSTOR EnviroStor Database Department of Toxic Substances Control 10/25/2021 10/26/2021 01/14/2022CA Financial Assurance 1 Financial Assurance Information Listing Department of Toxic Substances Control 10/05/2021 10/06/2021 12/29/2021CA Financial Assurance 2 Financial Assurance Information Listing California Integrated Waste Management Board 11/18/2021 11/19/2021 02/07/2022CA HAULERS Registered Waste Tire Haulers Listing Integrated Waste Management Board 09/14/2021 11/11/2021 11/23/2021CA HAZNET Facility and Manifest Data California Environmental Protection Agency 12/31/2019 04/15/2020 07/02/2020CA HIST CAL-SITES Calsites Database Department of Toxic Substance Control 08/08/2005 08/03/2006 08/24/2006CA HIST CORTESE Hazardous Waste & Substance Site List Department of Toxic Substances Control 04/01/2001 01/22/2009 04/08/2009CA HIST UST Hazardous Substance Storage Container Database State Water Resources Control Board 10/15/1990 01/25/1991 02/12/1991CA HWP EnviroStor Permitted Facilities Listing Department of Toxic Substances Control 11/15/2021 11/15/2021 02/03/2022CA HWT Registered Hazardous Waste Transporter Database Department of Toxic Substances Control 10/04/2021 10/05/2021 12/22/2021CA HWTS Hazardous Waste Tracking System Department of Toxic Substances Control 07/13/2021 07/14/2021 10/06/2021CA ICE ICE Department of Toxic Subsances Control 11/15/2021 11/15/2021 02/03/2022CA LDS Land Disposal Sites Listing (GEOTRACKER) State Water Qualilty Control Board 09/07/2021 09/07/2021 11/29/2021CA LIENS Environmental Liens Listing Department of Toxic Substances Control 08/25/2021 09/03/2021 11/22/2021CA LUST Leaking Underground Fuel Tank Report (GEOTRACKER) State Water Resources Control Board 09/07/2021 09/07/2021 11/29/2021CA LUST REG 1 Active Toxic Site Investigation California Regional Water Quality Control Boa 02/01/2001 02/28/2001 03/29/2001CA LUST REG 2 Fuel Leak List California Regional Water Quality Control Boa 09/30/2004 10/20/2004 11/19/2004CA LUST REG 3 Leaking Underground Storage Tank Database California Regional Water Quality Control Boa 05/19/2003 05/19/2003 06/02/2003CA LUST REG 4 Underground Storage Tank Leak List California Regional Water Quality Control Boa 09/07/2004 09/07/2004 10/12/2004CA LUST REG 5 Leaking Underground Storage Tank Database California Regional Water Quality Control Boa 07/01/2008 07/22/2008 07/31/2008CA LUST REG 6L Leaking Underground Storage Tank Case Listing California Regional Water Quality Control Boa 09/09/2003 09/10/2003 10/07/2003CA LUST REG 6V Leaking Underground Storage Tank Case Listing California Regional Water Quality Control Boa 06/07/2005 06/07/2005 06/29/2005CA LUST REG 7 Leaking Underground Storage Tank Case Listing California Regional Water Quality Control Boa 02/26/2004 02/26/2004 03/24/2004CA LUST REG 8 Leaking Underground Storage Tanks California Regional Water Quality Control Boa 02/14/2005 02/15/2005 03/28/2005CA LUST REG 9 Leaking Underground Storage Tank Report California Regional Water Quality Control Boa 03/01/2001 04/23/2001 05/21/2001CA MCS Military Cleanup Sites Listing (GEOTRACKER) State Water Resources Control Board 09/07/2021 09/07/2021 11/29/2021CA MILITARY PRIV SITES Military Privatized Sites (GEOTRACKER) State Water Resources Control Board 09/07/2021 09/07/2021 11/29/2021TC06852412.2r Page GR-1GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKINGSt Acronym Full Name Government Agency Gov Date Arvl. Date Active Date CA MILITARY UST SITES Military UST Sites (GEOTRACKER) State Water Resources Control Board 09/07/2021 09/07/2021 11/29/2021CA MINES Mines Site Location Listing Department of Conservation 09/07/2021 09/07/2021 11/29/2021CA MWMP Medical Waste Management Program Listing Department of Public Health 08/05/2021 08/31/2021 11/19/2021CA NON-CASE INFO Non-Case Information Sites (GEOTRACKER) State Water Resources Control Board 09/07/2021 09/07/2021 11/29/2021CA NOTIFY 65 Proposition 65 Records State Water Resources Control Board 03/12/2021 03/16/2021 06/01/2021CA NPDES NPDES Permits Listing State Water Resources Control Board 11/09/2021 11/09/2021 01/27/2022CA OTHER OIL GAS Other Oil & Gas Projects Sites (GEOTRACKER) State Water Resources Control Board 09/07/2021 09/07/2021 11/29/2021CA PEST LIC Pesticide Regulation Licenses Listing Department of Pesticide Regulation 08/30/2021 08/31/2021 11/19/2021CA PFAS PFAS Contamination Site Location Listing State Water Resources Control Board 09/07/2021 09/08/2021 12/01/2021CA PROC Certified Processors Database Department of Conservation 06/04/2021 06/04/2021 08/27/2021CA PROD WATER PONDS Produced Water Ponds Sites (GEOTRACKER) State Water Resources Control Board 09/07/2021 09/07/2021 11/29/2021CA PROJECT Project Sites (GEOTRACKER) State Water Resources Control Board 09/07/2021 09/07/2021 11/29/2021CA RESPONSE State Response Sites Department of Toxic Substances Control 10/25/2021 10/26/2021 01/14/2022CA RGA LF Recovered Government Archive Solid Waste Facilities List Department of Resources Recycling and Recover 07/01/2013 01/13/2014CA RGA LUST Recovered Government Archive Leaking Underground Storage Tan State Water Resources Control Board 07/01/2013 12/30/2013CA SAMPLING POINT Sampling Point ? Public Sites (GEOTRACKER) State Water Resources Control Board 09/07/2021 09/07/2021 11/29/2021CA SAN FRANCISCO AST Aboveground Storage Tank Site Listing San Francisco County Department of Public Hea 11/04/2021 11/05/2021 01/24/2022CA SCH School Property Evaluation Program Department of Toxic Substances Control 10/25/2021 10/26/2021 01/14/2022CA SLIC REG 1 Active Toxic Site Investigations California Regional Water Quality Control Boa 04/03/2003 04/07/2003 04/25/2003CA SLIC REG 2 Spills, Leaks, Investigation & Cleanup Cost Recovery Listing Regional Water Quality Control Board San Fran 09/30/200410/20/2004 11/19/2004CA SLIC REG 3 Spills, Leaks, Investigation & Cleanup Cost Recovery Listing California Regional Water Quality Control Boa 05/18/200605/18/2006 06/15/2006CA SLIC REG 4 Spills, Leaks, Investigation & Cleanup Cost Recovery Listing Region Water Quality Control Board Los Angele 11/17/200411/18/2004 01/04/2005CA SLIC REG 5 Spills, Leaks, Investigation & Cleanup Cost Recovery Listing Regional Water Quality Control Board Central 04/01/200504/05/2005 04/21/2005CA SLIC REG 6L SLIC Sites California Regional Water Quality Control Boa 09/07/2004 09/07/2004 10/12/2004CA SLIC REG 6V Spills, Leaks, Investigation & Cleanup Cost Recovery Listing Regional Water Quality Control Board, Victorv 05/24/2005 05/25/2005 06/16/2005CA SLIC REG 7 SLIC List California Regional Quality Control Board, Co 11/24/2004 11/29/2004 01/04/2005CA SLIC REG 8 Spills, Leaks, Investigation & Cleanup Cost Recovery Listing California Region Water Quality Control Board 04/03/200804/03/2008 04/14/2008CA SLIC REG 9 Spills, Leaks, Investigation & Cleanup Cost Recovery Listing California Regional Water Quality Control Boa 09/10/200709/11/2007 09/28/2007CA SPILLS 90 SPILLS90 data from FirstSearch FirstSearch 06/06/2012 01/03/2013 02/22/2013CA SWEEPS UST SWEEPS UST Listing State Water Resources Control Board 06/01/1994 07/07/2005 08/11/2005CA SWF/LF (SWIS) Solid Waste Information System Department of Resources Recycling and Recover 11/08/2021 11/09/2021 01/28/2022CA SWRCY Recycler Database Department of Conservation 09/07/2021 09/08/2021 11/29/2021CA TOXIC PITS Toxic Pits Cleanup Act Sites State Water Resources Control Board 07/01/1995 08/30/1995 09/26/1995CA UIC UIC Listing Deaprtment of Conservation 06/03/2021 06/03/2021 08/25/2021CA UIC GEO Underground Injection Control Sites (GEOTRACKER) State Water Resource Control Board 09/07/2021 09/07/2021 11/29/2021CA UST Active UST Facilities SWRCB 09/07/2021 09/07/2021 11/30/2021CA UST CLOSURE Proposed Closure of Underground Storage Tank (UST) Cases State Water Resources Control Board 08/18/2021 09/08/2021 12/03/2021CA VCP Voluntary Cleanup Program Properties Department of Toxic Substances Control 10/25/2021 10/26/2021 01/14/2022CA WASTEWATER PITS Oil Wastewater Pits Listing RWQCB, Central Valley Region 02/11/2021 07/01/2021 09/29/2021CA WDR Waste Discharge Requirements Listing State Water Resources Control Board 09/07/2021 09/08/2021 12/01/2021CA WDS Waste Discharge System State Water Resources Control Board 06/19/2007 06/20/2007 06/29/2007CA WELL STIM PROJ Well Stimulation Project (GEOTRACKER) State Water Resources Control Board 09/07/2021 09/07/2021 11/29/2021CA WIP Well Investigation Program Case List Los Angeles Water Quality Control Board 07/03/2009 07/21/2009 08/03/2009CA WMUDS/SWAT Waste Management Unit Database State Water Resources Control Board 04/01/2000 04/10/2000 05/10/2000US 2020 COR ACTION 2020 Corrective Action Program List Environmental Protection Agency 09/30/2017 05/08/2018 07/20/2018US ABANDONED MINES Abandoned Mines Department of Interior 09/14/2021 09/15/2021 12/15/2021US BRS Biennial Reporting System EPA/NTIS 12/31/2019 09/15/2021 12/14/2021TC06852412.2r Page GR-2GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKINGSt Acronym Full Name Government Agency Gov Date Arvl. Date Active Date US COAL ASH DOE Steam-Electric Plant Operation Data Department of Energy 12/31/2019 12/01/2020 02/09/2021US COAL ASH EPA Coal Combustion Residues Surface Impoundments List Environmental Protection Agency 01/12/2017 03/05/2019 11/11/2019US CONSENT Superfund (CERCLA) Consent Decrees Department of Justice, Consent Decree Library 09/30/2021 10/13/2021 01/10/2022US CORRACTS Corrective Action Report EPA 09/13/2021 09/15/2021 10/12/2021US DEBRIS REGION 9 Torres Martinez Reservation Illegal Dump Site Locations EPA, Region 9 01/12/2009 05/07/2009 09/21/2009US DOCKET HWC Hazardous Waste Compliance Docket Listing Environmental Protection Agency 05/06/2021 05/21/2021 08/11/2021US DOD Department of Defense Sites USGS 12/31/2005 11/10/2006 01/11/2007US DOT OPS Incident and Accident Data Department of Transporation, Office of Pipeli 01/02/2020 01/28/2020 04/17/2020US Delisted NPL National Priority List Deletions EPA 10/20/2021 11/05/2021 11/29/2021US ECHO Enforcement & Compliance History Information Environmental Protection Agency 01/01/2022 01/04/2022 01/10/2022US EDR Hist Auto EDR Exclusive Historical Auto Stations EDR, Inc.US EDR Hist Cleaner EDR Exclusive Historical Cleaners EDR, Inc.US EDR MGP EDR Proprietary Manufactured Gas Plants EDR, Inc.US EPA WATCH LIST EPA WATCH LIST Environmental Protection Agency 08/30/2013 03/21/2014 06/17/2014US ERNS Emergency Response Notification System National Response Center, United States Coast 09/13/2021 09/21/2021 12/15/2021US FEDERAL FACILITY Federal Facility Site Information listing Environmental Protection Agency 05/25/2021 06/24/2021 09/20/2021US FEDLAND Federal and Indian Lands U.S. Geological Survey 04/02/2018 04/11/2018 11/06/2019US FEMA UST Underground Storage Tank Listing FEMA 10/14/2021 11/05/2021 02/01/2022US FINDS Facility Index System/Facility Registry System EPA 05/05/2021 05/18/2021 08/17/2021US FTTS FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fu EPA/Office of Prevention, Pesticides and Toxi 04/09/2009 04/16/2009 05/11/2009US FTTS INSP FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fu EPA 04/09/2009 04/16/2009 05/11/2009US FUDS Formerly Used Defense Sites U.S. Army Corps of Engineers 10/26/2021 11/16/2021 02/08/2022US FUELS PROGRAM EPA Fuels Program Registered Listing EPA 11/15/2021 11/15/2021 02/01/2022US FUSRAP Formerly Utilized Sites Remedial Action Program Department of Energy 07/26/2021 07/27/2021 10/22/2021US HIST FTTS FIFRA/TSCA Tracking System Administrative Case Listing Environmental Protection Agency 10/19/2006 03/01/2007 04/10/2007US HIST FTTS INSP FIFRA/TSCA Tracking System Inspection & Enforcement Case Lis Environmental Protection Agency 10/19/2006 03/01/200704/10/2007US HMIRS Hazardous Materials Information Reporting System U.S. Department of Transportation 09/12/2021 09/13/2021 09/28/2021US ICIS Integrated Compliance Information System Environmental Protection Agency 11/18/2016 11/23/2016 02/10/2017US IHS OPEN DUMPS Open Dumps on Indian Land Department of Health & Human Serivces, Indian 04/01/2014 08/06/2014 01/29/2015US INDIAN LUST R1 Leaking Underground Storage Tanks on Indian Land EPA Region 1 04/28/2021 06/11/2021 09/07/2021US INDIAN LUST R10 Leaking Underground Storage Tanks on Indian Land EPA Region 10 10/12/2021 11/15/2021 02/08/2022US INDIAN LUST R4 Leaking Underground Storage Tanks on Indian Land EPA Region 4 05/28/2021 06/22/2021 09/20/2021US INDIAN LUST R5 Leaking Underground Storage Tanks on Indian Land EPA, Region 5 10/12/2021 11/15/2021 02/08/2022US INDIAN LUST R6 Leaking Underground Storage Tanks on Indian Land EPA Region 6 10/12/2021 11/15/2021 02/08/2022US INDIAN LUST R7 Leaking Underground Storage Tanks on Indian Land EPA Region 7 10/12/2021 11/15/2021 02/08/2022US INDIAN LUST R8 Leaking Underground Storage Tanks on Indian Land EPA Region 8 10/12/2021 11/15/2021 02/08/2022US INDIAN LUST R9 Leaking Underground Storage Tanks on Indian Land Environmental Protection Agency 10/12/2021 11/15/2021 02/08/2022US INDIAN ODI Report on the Status of Open Dumps on Indian Lands Environmental Protection Agency 12/31/1998 12/03/2007 01/24/2008US INDIAN RESERV Indian Reservations USGS 12/31/2014 07/14/2015 01/10/2017US INDIAN UST R1 Underground Storage Tanks on Indian Land EPA, Region 1 10/14/2021 11/15/2021 02/08/2022US INDIAN UST R10 Underground Storage Tanks on Indian Land EPA Region 10 10/12/2021 11/15/2021 02/08/2022US INDIAN UST R4 Underground Storage Tanks on Indian Land EPA Region 4 05/28/2021 06/22/2021 09/20/2021US INDIAN UST R5 Underground Storage Tanks on Indian Land EPA Region 5 04/06/2021 06/11/2021 09/07/2021US INDIAN UST R6 Underground Storage Tanks on Indian Land EPA Region 6 10/12/2021 11/15/2021 02/08/2022US INDIAN UST R7 Underground Storage Tanks on Indian Land EPA Region 7 10/12/2021 11/15/2021 02/08/2022US INDIAN UST R8 Underground Storage Tanks on Indian Land EPA Region 8 10/12/2021 11/15/2021 02/08/2022US INDIAN UST R9 Underground Storage Tanks on Indian Land EPA Region 9 10/12/2021 11/15/2021 02/08/2022TC06852412.2r Page GR-3GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKINGSt Acronym Full Name Government Agency Gov Date Arvl. Date Active Date US INDIAN VCP R1 Voluntary Cleanup Priority Listing EPA, Region 1 07/27/2015 09/29/2015 02/18/2016US INDIAN VCP R7 Voluntary Cleanup Priority Lisitng EPA, Region 7 03/20/2008 04/22/2008 05/19/2008US LEAD SMELTER 1 Lead Smelter Sites Environmental Protection Agency 10/20/2021 11/05/2021 11/29/2021US LEAD SMELTER 2 Lead Smelter Sites American Journal of Public Health 04/05/2001 10/27/2010 12/02/2010US LIENS 2 CERCLA Lien Information Environmental Protection Agency 10/20/2021 11/05/2021 11/29/2021US LUCIS Land Use Control Information System Department of the Navy 11/15/2021 11/16/2021 02/08/2022US MINES MRDS Mineral Resources Data System USGS 04/06/2018 10/21/2019 10/24/2019US MINES VIOLATIONS MSHA Violation Assessment Data DOL, Mine Safety & Health Admi 06/30/2021 07/01/2021 09/28/2021US MLTS Material Licensing Tracking System Nuclear Regulatory Commission 07/29/2021 08/24/2021 11/19/2021US NPL National Priority List EPA 10/20/2021 11/05/2021 11/29/2021US NPL LIENS Federal Superfund Liens EPA 10/15/1991 02/02/1994 03/30/1994US ODI Open Dump Inventory Environmental Protection Agency 06/30/1985 08/09/2004 09/17/2004US PADS PCB Activity Database System EPA 11/19/2020 01/08/2021 03/22/2021US PCB TRANSFORMER PCB Transformer Registration Database Environmental Protection Agency 09/13/2019 11/06/2019 02/10/2020US PCS Permit Compliance System EPA, Office of Water 07/14/2011 08/05/2011 09/29/2011US PCS ENF Enforcement data EPA 12/31/2014 02/05/2015 03/06/2015US PCS INACTIVE Listing of Inactive PCS Permits EPA 11/05/2014 01/06/2015 05/06/2015US PRP Potentially Responsible Parties EPA 10/20/2021 11/05/2021 12/15/2021US Proposed NPL Proposed National Priority List Sites EPA 10/20/2021 11/05/2021 11/29/2021US RAATS RCRA Administrative Action Tracking System EPA 04/17/1995 07/03/1995 08/07/1995US RADINFO Radiation Information Database Environmental Protection Agency 07/01/2019 07/01/2019 09/23/2019US RCRA NonGen / NLR RCRA - Non Generators / No Longer Regulated Environmental Protection Agency 09/13/2021 09/15/2021 10/12/2021US RCRA-LQG RCRA - Large Quantity Generators Environmental Protection Agency 09/13/2021 09/15/2021 10/12/2021US RCRA-SQG RCRA - Small Quantity Generators Environmental Protection Agency 09/13/2021 09/15/2021 10/12/2021US RCRA-TSDF RCRA - Treatment, Storage and Disposal Environmental Protection Agency 09/13/2021 09/15/2021 10/12/2021US RCRA-VSQG RCRA - Very Small Quantity Generators (Formerly Conditionall Environmental Protection Agency 09/13/2021 09/15/2021 10/12/2021US RMP Risk Management Plans Environmental Protection Agency 10/20/2021 11/05/2021 11/12/2021US ROD Records Of Decision EPA 10/20/2021 11/05/2021 11/29/2021US SCRD DRYCLEANERS State Coalition for Remediation of Drycleaners Listing Environmental Protection Agency 01/01/2017 02/03/2017 04/07/2017US SEMS Superfund Enterprise Management System EPA 10/20/2021 11/05/2021 11/29/2021US SEMS-ARCHIVE Superfund Enterprise Management System Archive EPA 10/20/2021 11/05/2021 11/29/2021US SSTS Section 7 Tracking Systems EPA 10/18/2021 10/20/2021 01/10/2022US TRIS Toxic Chemical Release Inventory System EPA 12/31/2018 08/14/2020 11/04/2020US TSCA Toxic Substances Control Act EPA 12/31/2016 06/17/2020 09/10/2020US UMTRA Uranium Mill Tailings Sites Department of Energy 08/30/2019 11/15/2019 01/28/2020US US AIRS (AFS) Aerometric Information Retrieval System Facility Subsystem ( EPA 10/12/2016 10/26/2016 02/03/2017US US AIRS MINOR Air Facility System Data EPA 10/12/2016 10/26/2016 02/03/2017US US BROWNFIELDS A Listing of Brownfields Sites Environmental Protection Agency 06/10/2021 06/10/2021 08/17/2021US US CDL Clandestine Drug Labs Drug Enforcement Administration 11/16/2021 11/18/2021 02/08/2022US US ENG CONTROLS Engineering Controls Sites List Environmental Protection Agency 08/23/2021 08/23/2021 11/12/2021US US FIN ASSUR Financial Assurance Information Environmental Protection Agency 09/13/2021 09/15/2021 09/28/2021US US HIST CDL National Clandestine Laboratory Register Drug Enforcement Administration 11/16/2021 11/18/2021 02/08/2022US US INST CONTROLS Institutional Controls Sites List Environmental Protection Agency 08/23/2021 08/23/2021 11/12/2021US US MINES Mines Master Index File Department of Labor, Mine Safety and Health A 08/09/2021 08/24/2021 11/19/2021US US MINES 2 Ferrous and Nonferrous Metal Mines Database Listing USGS 05/06/2020 05/27/2020 08/13/2020US US MINES 3 Active Mines & Mineral Plants Database Listing USGS 04/14/2011 06/08/2011 09/13/2011US UXO Unexploded Ordnance Sites Department of Defense 12/31/2018 07/02/2020 09/17/2020TC06852412.2r Page GR-4GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKINGSt Acronym Full Name Government Agency Gov Date Arvl. Date Active Date CT CT MANIFEST Hazardous Waste Manifest Data Department of Energy & Environmental Protecti 11/11/2021 11/12/2021 02/01/2022NJ NJ MANIFEST Manifest Information Department of Environmental Protection 12/31/2018 04/10/2019 05/16/2019NY NY MANIFEST Facility and Manifest Data Department of Environmental Conservation 01/01/2019 10/29/2021 01/19/2022PA PA MANIFEST Manifest Information Department of Environmental Protection 06/30/2018 07/19/2019 09/10/2019RI RI MANIFEST Manifest information Department of Environmental Management 12/31/2019 02/11/2021 02/24/2021WI WI MANIFEST Manifest Information Department of Natural Resources 05/31/2018 06/19/2019 09/03/2019US AHA Hospitals Sensitive Receptor: AHA Hospitals American Hospital Association, Inc.US Medical Centers Sensitive Receptor: Medical Centers Centers for Medicare & Medicaid ServicesUS Nursing Homes Sensitive Receptor: Nursing Homes National Institutes of HealthUS Public Schools Sensitive Receptor: Public Schools National Center for Education StatisticsUS Private Schools Sensitive Receptor: Private Schools National Center for Education StatisticsCA Daycare Centers Sensitive Receptor: Licensed Facilities Department of Social ServicesUS Flood Zones 100-year and 500-year flood zones Emergency Management Agency (FEMA)US NWI National Wetlands Inventory U.S. Fish and Wildlife ServiceCA State Wetlands Wetland Inventory Department of Fish and WildlifeUS Topographic MapU.S. Geological SurveyUS Oil/Gas PipelinesEndeavor Business MediaUS Electric Power Transmission Line Data Endeavor Business MediaSTREET AND ADDRESS INFORMATIONÂ© 2015 TomTom North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protectionand other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subjectto the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material.TC06852412.2r Page GR-5GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKINGSt Acronym Full Name Government Agency Gov Date Arvl. Date Active Date TC06852412.2r Page A-1 geologic strata. of the soil, and nearby wells. Groundwater flow velocity is generally impacted by the nature of the Groundwater flow direction may be impacted by surface topography, hydrology, hydrogeology, characteristics 2. Groundwater flow velocity. 1. Groundwater flow direction, and Assessment of the impact of contaminant migration generally has two principle investigative components: forming an opinion about the impact of potential contaminant migration. EDR’s GeoCheck Physical Setting Source Addendum is provided to assist the environmental professional in 2018Version Date: 12015973 GUASTI, CAWest Map: 2018Version Date: 12015969 FONTANA, CATarget Property Map: USGS TOPOGRAPHIC MAP 1035 ft. above sea levelElevation: 3769739.5UTM Y (Meters): 454642.3UTM X (Meters): Zone 11Universal Tranverse Mercator: 117.491547 - 117ˆ 29’ 29.57’’Longitude (West): 34.069167 - 34ˆ 4’ 9.00’’Latitude (North): TARGET PROPERTY COORDINATES FONTANA, CA 92335 14387 VALLEY BOULEVARD 14387 VALLEY BOULEVARD TARGET PROPERTY ADDRESS ®GEOCHECK - PHYSICAL SETTING SOURCE ADDENDUM® TC06852412.2r Page A-2 should be field verified. on a relative (not an absolute) basis. Relative elevation information between sites of close proximity Source: Topography has been determined from the USGS 7.5’ Digital Elevation Model and should be evaluated SURROUNDING TOPOGRAPHY: ELEVATION PROFILES Elevation (ft)Elevation (ft)TP TP 0 1/2 1 Miles✩Target Property Elevation: 1035 ft. North South West East961969977985992100110111019102610351043105010591068107710851096110111241021102310241025102610251026102910321035103910411044104710521057106310651068General SSWGeneral Topographic Gradient: TARGET PROPERTY TOPOGRAPHY should contamination exist on the target property, what downgradient sites might be impacted. assist the environmental professional in forming an opinion about the impact of nearby contaminated properties or, Surface topography may be indicative of the direction of surficial groundwater flow. This information can be used to TOPOGRAPHIC INFORMATION collected on nearby properties, and regional groundwater flow information (from deep aquifers). sources of information, such as surface topographic information, hydrologic information, hydrogeologic data using site-specific well data. If such data is not reasonably ascertainable, it may be necessary to rely on other Groundwater flow direction for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW DIRECTION INFORMATION ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC06852412.2r Page A-3 GENERAL DIRECTIONLOCATION GROUNDWATER FLOWFROM TPMAP ID hydrogeologically, and the depth to water table. authorities at select sites and has extracted the date of the report, groundwater flow direction as determined flow at specific points. EDR has reviewed reports submitted by environmental professionals to regulatory EDR has developed the AQUIFLOW Information System to provide data on the general direction of groundwater AQUIFLOW® Search Radius: 1.000 Mile. * ©1996 Site-specific hydrogeological data gathered by CERCLIS Alerts, Inc., Bainbridge Island, WA. All rights reserved. All of the information and opinions presented are those of the cited EPA report(s), which were completed under a Comprehensive Environmental Response Compensation and Liability Information System (CERCLIS) investigation. Information is inferred in the CERCLIS investigation report(s) Data Quality: No information about a sole source aquifer is available Sole Source Aquifer: Permeable soils are present above the identified ground water. Hydraulic Connection: approximately 280 feet. Inferred Depth to Water: Southwest Groundwater Flow Direction: CAD076080563 Site EPA ID Number: Western States Refining Site Name: 1/4 - 1/2 Mile SSW Location Relative to TP: 1.25 miles Search Radius: Site-Specific Hydrogeological Data*: * ©1996 Site-specific hydrogeological data gathered by CERCLIS Alerts, Inc., Bainbridge Island, WA. All rights reserved. All of the information and opinions presented are those of the cited EPA report(s), which were completed under a Comprehensive Environmental Response Compensation and Liability Information System (CERCLIS) investigation. contamination exist on the target property, what downgradient sites might be impacted. environmental professional in forming an opinion about the impact of nearby contaminated properties or, should of groundwater flow direction in the immediate area. Such hydrogeologic information can be used to assist the Hydrogeologic information obtained by installation of wells on a specific site can often be an indicator HYDROGEOLOGIC INFORMATION YES - refer to the Overview Map and Detail MapFONTANA NATIONAL WETLAND INVENTORY NWI Electronic Data CoverageNWI Quad at Target Property FEMA FIRM Flood data06071C8665H FEMA FIRM Flood data06065C0017G FEMA FIRM Flood data06071C8634J Additional Panels in search area:FEMA Source Type FEMA FIRM Flood data06071C8653H Flood Plain Panel at Target Property FEMA Source Type FEMA FLOOD ZONE and bodies of water). Refer to the Physical Setting Source Map following this summary for hydrologic information (major waterways contamination exist on the target property, what downgradient sites might be impacted. the environmental professional in forming an opinion about the impact of nearby contaminated properties or, should Surface water can act as a hydrologic barrier to groundwater flow. Such hydrologic information can be used to assist HYDROLOGIC INFORMATION ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC06852412.2r Page A-4 For additional site information, refer to Physical Setting Source Map Findings. SSW1/2 - 1 Mile NW1G SSW1/2 - 1 Mile NW15 GENERAL DIRECTIONLOCATION GROUNDWATER FLOWFROM TPMAP ID ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC06852412.2r Page A-5 Map, USGS Digital Data Series DDS - 11 (1994). of the Conterminous U.S. at 1:2,500,000 Scale - a digital representation of the 1974 P.B. King and H.M. Beikman Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology ROCK STRATIGRAPHIC UNIT GEOLOGIC AGE IDENTIFICATION Stratifed SequenceCategory:CenozoicEra: QuaternarySystem: QuaternarySeries: QCode: (decoded above as Era, System & Series) at which contaminant migration may be occurring. Geologic information can be used by the environmental professional in forming an opinion about the relative speed GEOLOGIC INFORMATION IN GENERAL AREA OF TARGET PROPERTY move more quickly through sandy-gravelly types of soils than silty-clayey types of soils. characteristics data collected on nearby properties and regional soil information. In general, contaminant plumes to rely on other sources of information, including geologic age identification, rock stratigraphic unit and soil using site specific geologic and soil strata data. If such data are not reasonably ascertainable, it may be necessary Groundwater flow velocity information for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW VELOCITY INFORMATION ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc. 1 2 0 1/16 1/8 1/4 Miles TC06852412.2r Page A-7 Min: 6.1 Max: 7.3 Min: 42 Max: 141 Silty Sand. Sands with fines, SOILS, Sands, COARSE-GRAINED sand. Poorly graded Clean Sands, SOILS, Sands, COARSE-GRAINED Sand. Gravel and Fragments, 200), Stone passing No. pct. or less materials (35 Granulargravelly sand59 inches35 inches 2 Min: 6.1 Max: 7.3 Min: 42 Max: 141 Silty Sand. Sands with fines, SOILS, Sands, COARSE-GRAINED sand. Poorly graded Clean Sands, SOILS, Sands, COARSE-GRAINED Sand. Gravel and Fragments, 200), Stone passing No. pct. or less materials (35 Granular sand gravelly loamy35 inches 0 inches 1 Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH) > 0 inchesDepth to Watertable Min: > 0 inchesDepth to Bedrock Min: ModerateCorrosion Potential - Uncoated Steel: Hydric Status: Not hydric Somewhat excessively drainedSoil Drainage Class: excessively drained sands and gravels. Class A - High infiltration rates. Soils are deep, well drained toHydrologic Group: gravelly loamy sandSoil Surface Texture: TUJUNGASoil Component Name: Soil Map ID: 1 in a landscape. The following information is based on Soil Conservation Service SSURGO data. for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patterns Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey information The U.S. Department of Agriculture’s (USDA) Soil Conservation Service (SCS) leads the National Cooperative Soil DOMINANT SOIL COMPOSITION IN GENERAL AREA OF TARGET PROPERTY ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC06852412.2r Page A-8 opinion about the impact of contaminant migration on nearby drinking water wells. professional in assessing sources that may impact ground water flow direction, and in forming an EDR Local/Regional Water Agency records provide water well information to assist the environmental LOCAL / REGIONAL WATER AGENCY RECORDS Min: 6.1 Max: 7.8 Min: 42 Max: 141 Silty Sand. Sands with fines, SOILS, Sands, COARSE-GRAINED Sand. Gravel and Fragments, 200), Stone passing No. pct. or less materials (35 Granularloamy sand59 inches18 inches 2 Min: 6.1 Max: 7.8 Min: 42 Max: 141 Silty Sand. Sands with fines, SOILS, Sands, COARSE-GRAINED Sand. Gravel and Fragments, 200), Stone passing No. pct. or less materials (35 Granular sand gravelly loamy18 inches 0 inches 1 Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH) > 0 inchesDepth to Watertable Min: > 0 inchesDepth to Bedrock Min: ModerateCorrosion Potential - Uncoated Steel: Hydric Status: Not hydric Somewhat excessively drainedSoil Drainage Class: excessively drained sands and gravels. Class A - High infiltration rates. Soils are deep, well drained toHydrologic Group: gravelly loamy sandSoil Surface Texture: TUJUNGASoil Component Name: Soil Map ID: 2 ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC06852412.2r Page A-9 1/2 - 1 Mile NNWCADDW0000000255 E18 1/2 - 1 Mile NNWCADDW0000014006 E17 1/2 - 1 Mile SECADDW0000014766 D16 1/2 - 1 Mile SE1042 D14 1/2 - 1 Mile SECADDW0000017716 D13 1/2 - 1 Mile SECAUSGSN00007462 D12 1/2 - 1 Mile SECAUSGS000002903 D11 1/2 - 1 Mile NNE1041 C10 1/2 - 1 Mile NNECAUSGSN00013587 C8 1/2 - 1 Mile NNECAUSGSN00003867 B7 1/2 - 1 Mile NNECADDW0000000254 B6 1/2 - 1 Mile NNE18807 B5 1/2 - 1 Mile NECADWR0000029057 4 1/2 - 1 Mile NNECADDW0000017557 B3 1/2 - 1 Mile ESECADDW0000011314 A2 1/4 - 1/2 Mile ESE1040 A1 STATE DATABASE WELL INFORMATION LOCATION FROM TPWELL IDMAP ID Note: PWS System location is not always the same as well location. No PWS System Found FEDERAL FRDS PUBLIC WATER SUPPLY SYSTEM INFORMATION LOCATION FROM TPWELL IDMAP ID 1/2 - 1 Mile NNEUSGS40000140669 C9 FEDERAL USGS WELL INFORMATION LOCATION FROM TPWELL IDMAP ID 1.000State Database Nearest PWS within 1 mileFederal FRDS PWS 1.000Federal USGS WELL SEARCH DISTANCE INFORMATION SEARCH DISTANCE (miles)DATABASE ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc. 1 1 2 0 1080 1 0 4 01040 1040 1 000 9 6 0 60 1160 1 1 2 0 1120 1120 10401 0 80 1080 960 960 960 960 100 1000 1000 1 0 40 1040 1 0 4 0 CA EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc. GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® Map ID Direction Distance Elevation EDR ID NumberDatabase A1 ESE 1/4 - 1/2 Mile Higher 1040CA WELLSClick here for full text details A2 ESE 1/2 - 1 Mile Higher CADDW0000011314CA WELLSClick here for full text details B3 NNE 1/2 - 1 Mile Higher CADDW0000017557CA WELLSClick here for full text details 4 NE 1/2 - 1 Mile Higher CADWR0000029057CA WELLSClick here for full text details B5 NNE 1/2 - 1 Mile Higher 18807CA WELLSClick here for full text details B6 NNE 1/2 - 1 Mile Higher CADDW0000000254CA WELLSClick here for full text details B7 NNE 1/2 - 1 Mile Higher CAUSGSN00003867CA WELLSClick here for full text details C8 NNE 1/2 - 1 Mile Higher CAUSGSN00013587CA WELLSClick here for full text details Page: 1 ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® Map ID Direction Distance Elevation EDR ID NumberDatabase C9 NNE 1/2 - 1 Mile Higher USGS40000140669FED USGSClick here for full text details C10 NNE 1/2 - 1 Mile Higher 1041CA WELLSClick here for full text details D11 SE 1/2 - 1 Mile Lower CAUSGS000002903CA WELLSClick here for full text details D12 SE 1/2 - 1 Mile Lower CAUSGSN00007462CA WELLSClick here for full text details D13 SE 1/2 - 1 Mile Lower CADDW0000017716CA WELLSClick here for full text details D14 SE 1/2 - 1 Mile Lower 1042CA WELLSClick here for full text details 15 NW 1/2 - 1 Mile Higher 50256AQUIFLOWClick here for full text details D16 SE 1/2 - 1 Mile Lower CADDW0000014766CA WELLSClick here for full text details E17 NNW 1/2 - 1 Mile Lower CADDW0000014006CA WELLSClick here for full text details Page: 2 ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® Map ID Direction Distance Elevation EDR ID NumberDatabase E18 NNW 1/2 - 1 Mile Lower CADDW0000000255CA WELLSClick here for full text details 1G NW 1/2 - 1 Mile Lower 50256AQUIFLOWClick here for full text details Page: 3 Not ReportedNot ReportedNot ReportedNot ReportedBasement Not ReportedNot ReportedNot ReportedNot ReportedLiving Area - 2nd Floor 0%0%100%0.678 pCi/LLiving Area - 1st Floor % >20 pCi/L% 4-20 pCi/L% <4 pCi/LAverage ActivityArea Number of sites tested: 18 Federal Area Radon Information for SAN BERNARDINO COUNTY, CA : Zone 3 indoor average level < 2 pCi/L. : Zone 2 indoor average level >= 2 pCi/L and <= 4 pCi/L. Note: Zone 1 indoor average level > 4 pCi/L. Federal EPA Radon Zone for SAN BERNARDINO County: 2 05692335 ______________________ > 4 pCi/LNum TestsZipcode Radon Test Results State Database: CA Radon AREA RADON INFORMATION GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS RADON ® TC06852412.2r Page 4 EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc. TOPOGRAPHIC INFORMATION USGS 7.5’ Digital Elevation Model (DEM) Source: United States Geologic Survey EDR acquired the USGS 7.5’ Digital Elevation Model in 2002 and updated it in 2006. The 7.5 minute DEM corresponds to the USGS 1:24,000- and 1:25,000-scale topographic quadrangle maps. The DEM provides elevation data with consistent elevation units and projection. Source: U.S. Geological Survey HYDROLOGIC INFORMATION Flood Zone Data: This data was obtained from the Federal Emergency Management Agency (FEMA). It depicts 100-year and 500-year flood zones as defined by FEMA. It includes the National Flood Hazard Layer (NFHL) which incorporates Flood Insurance Rate Map (FIRM) data and Q3 data from FEMA in areas not covered by NFHL. Source: FEMA Telephone: 877-336-2627 Date of Government Version: 2003, 2015 NWI: National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002, 2005 and 2010 from the U.S. Fish and Wildlife Service. State Wetlands Data: Wetland Inventory Source: Department of Fish and Wildlife Telephone: 916-445-0411 HYDROGEOLOGIC INFORMATION AQUIFLOW Information SystemR Source: EDR proprietary database of groundwater flow information EDR has developed the AQUIFLOW Information System (AIS) to provide data on the general direction of groundwater flow at specific points. EDR has reviewed reports submitted to regulatory authorities at select sites and has extracted the date of the report, hydrogeologically determined groundwater flow direction and depth to water table information. GEOLOGIC INFORMATION Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology of the Conterminous U.S. at 1:2,500,000 Scale - A digital representation of the 1974 P.B. King and H.M. Beikman Map, USGS Digital Data Series DDS - 11 (1994). STATSGO: State Soil Geographic Database Source: Department of Agriculture, Natural Resources Conservation Service (NRCS) The U.S. Department of Agriculture’s (USDA) Natural Resources Conservation Service (NRCS) leads the national Conservation Soil Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey information for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patterns in a landscape. Soil maps for STATSGO are compiled by generalizing more detailed (SSURGO) soil survey maps. SSURGO: Soil Survey Geographic Database Source: Department of Agriculture, Natural Resources Conservation Service (NRCS) Telephone: 800-672-5559 SSURGO is the most detailed level of mapping done by the Natural Resources Conservation Service, mapping scales generally range from 1:12,000 to 1:63,360. Field mapping methods using national standards are used to construct the soil maps in the Soil Survey Geographic (SSURGO) database. SSURGO digitizing duplicates the original soil survey maps. This level of mapping is designed for use by landowners, townships and county natural resource planning and management. TC06852412.2r Page PSGR-1 PHYSICAL SETTING SOURCE RECORDS SEARCHED LOCAL / REGIONAL WATER AGENCY RECORDS FEDERAL WATER WELLS PWS: Public Water Systems Source: EPA/Office of Drinking Water Telephone: 202-564-3750 Public Water System data from the Federal Reporting Data System. A PWS is any water system which provides water to at least 25 people for at least 60 days annually. PWSs provide water from wells, rivers and other sources. PWS ENF: Public Water Systems Violation and Enforcement Data Source: EPA/Office of Drinking Water Telephone: 202-564-3750 Violation and Enforcement data for Public Water Systems from the Safe Drinking Water Information System (SDWIS) after August 1995. Prior to August 1995, the data came from the Federal Reporting Data System (FRDS). USGS Water Wells: USGS National Water Inventory System (NWIS) This database contains descriptive information on sites where the USGS collects or has collected data on surface water and/or groundwater. The groundwater data includes information on wells, springs, and other sources of groundwater. OTHER STATE DATABASE INFORMATION Groundwater Ambient Monitoring & Assessment Program State Water Resources Control Board Telephone: 916-341-5577 The GAMA Program is Californias comprehensive groundwater quality monitoring program. GAMA collects data by testing the untreated, raw water in different types of wells for naturally-occurring and man-made chemicals. The GAMA data includes Domestic, Monitoring and Municipal well types from the following sources, Department of Water Resources, Department of Heath Services, EDF, Agricultural Lands, Lawrence Livermore National Laboratory, Department of Pesticide Regulation, United States Geological Survey, Groundwater Ambient Monitoring and Assessment Program and Local Groundwater Projects. Water Well Database Source: Department of Water Resources Telephone: 916-651-9648 California Drinking Water Quality Database Source: Department of Public Health Telephone: 916-324-2319 The database includes all drinking water compliance and special studies monitoring for the state of California since 1984. It consists of over 3,200,000 individual analyses along with well and water system information. California Oil and Gas Well Locations Source: Dept of Conservation, Geologic Energy Management Division Telephone: 916-323-1779 Oil and Gas well locations in the state. California Earthquake Fault Lines Source: California Division of Mines and Geology The fault lines displayed on EDR’s Topographic map are digitized quaternary fault lines prepared in 1975 by the United State Geological Survey. Additional information (also from 1975) regarding activity at specific fault lines comes from California’s Preliminary Fault Activity Map prepared by the California Division of Mines and Geology. RADON State Database: CA Radon Source: Department of Public Health Telephone: 916-210-8558 Radon Database for California TC06852412.2r Page PSGR-2 PHYSICAL SETTING SOURCE RECORDS SEARCHED Area Radon Information Source: USGS Telephone: 703-356-4020 The National Radon Database has been developed by the U.S. Environmental Protection Agency (USEPA) and is a compilation of the EPA/State Residential Radon Survey and the National Residential Radon Survey. The study covers the years 1986 - 1992. Where necessary data has been supplemented by information collected at private sources such as universities and research institutions. EPA Radon Zones Source: EPA Telephone: 703-356-4020 Sections 307 & 309 of IRAA directed EPA to list and identify areas of U.S. with the potential for elevated indoor radon levels. OTHER Airport Landing Facilities: Private and public use landing facilities Source: Federal Aviation Administration, 800-457-6656 Epicenters: World earthquake epicenters, Richter 5 or greater Source: Department of Commerce, National Oceanic and Atmospheric Administration California Earthquake Fault Lines: The fault lines displayed on EDR’s Topographic map are digitized quaternary fault lines, prepared in 1975 by the United State Geological Survey. Additional information (also from 1975) regarding activity at specific fault lines comes from California’s Preliminary Fault Activity Map prepared by the California Division of Mines and Geology. STREET AND ADDRESS INFORMATION Â© 2015 TomTom North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protection and other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subject to the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material. TC06852412.2r Page PSGR-3 PHYSICAL SETTING SOURCE RECORDS SEARCHED Hillmann Consulting LLC Phase I Environmental Site Assessment Hillmann Project No.: C3-8909 14387 Valley Boulevard, Fontana, California APPENDIX F OTHER DOCUMENTS Units PHG (MCLG)MCL Sample Year Likely Source of Detected Constituent % (0)5% (a)2020 Naturally present in the environment Units PHG (MCLG)MCL Range Average Sample Year Likely Source of Detected Constituent pCi/L (0) 15 ND - 9.38 1.93 2018-20 Erosion of natural deposits ppm 10 10 ND - 7.80 4.56 2020 Runoff and leaching from fertilizer use; leaching from septic tanks and sewage; erosion of natural deposits ppb 1 6 ND - 5.20 0.33 2020 Perchlorate is an inorganic chemical used in solid rocket propellant, fireworks, explosives, flares, matches, and a variety of industries. It usually gets into drinking water as a result of environmental contamination from historic aerospace or other industrial operations that used or use, store, or dispose of perchlorate and its salts. ppb 0.02 NS ND - 3.40 1.40 2020 Discharge from electroplating factories,leather tanneries,wood preservation chemical synthesis, refractory production, and textile manufacturing facilities;erosion of natural deposits ppm NS 500 4.40 - 51.00 16.44 2020 Runoff and leaching from natural deposits; seawater influence units NS 3 1.00 - 2.00 0.96 2020 Naturally-occurring organic materials µmho/cm NS 1,600 360.00 - 430.00 394.23 2020 Substances that form ions when in water; seawater influence ppm NS 500 14.00 - 37.00 23.35 2020 Runoff and leaching from natural deposits; industrial wastes ppm NS 1,000 120.00 - 280.00 234.81 2020 Runoff and leaching from natural deposits NTU NS 5 ND - 0.15 0.02 2020 Soil runoff ppb NS 5,000 ND - 70.00 2.69 2020 Runoff/leaching from natural deposits; industrial wastes ppm NS NS 110.00 - 210.00 179.62 2020 Unknown ppb NS NS ND - 130.00 9.23 2020 Unknown ppb NS NS ND - 22.90 8.13 2020 Unknown ppb NS NS ND - 7.80 2.38 2020 Unknown ppm NS NS 26.30 - 58.90 47.90 2020 Unknown ppb NS NS ND - 18.40 6.10 2020 Unknown ppb NS NS ND - 25.50 8.33 2020 Unknown ppm NS NS 103.00 -175.00 150.04 2020 Runoff and leaching from natural deposits ppm NS NS 4.33 - 9.29 7.41 2020 Unknown ppb NS NS ND - 0.56 0.02 2020 Unknown ppb NS NS ND - 4.20 1.73 2015 Unknown ppt NS NS ND - 2.40 0.99 2018 Unknown units NS NS 7.47 - 8.15 7.78 2020 Unknown ppm NS NS 1.50 - 2.70 2.02 2020 Unknown ppm NS NS 10.00 - 41.00 20.77 2020 Runoff and leaching from natural deposits ppb NS NS ND - 360.00 170.77 2015 Unknown ppm NS NS 1.10 - 2.20 1.61 2020 Runoff and leaching from natural deposits ppb NS NS ND -10.00 3.16 2015 Unknown ppb NS NS ND - 2.50 0.17 2020 Unknown ppb NS NS ND - 0.78 0.03 2020 Unknown ppb NS NS 3.90 - 5.30 3.72 2020 Unknown ppb NS NS ND - 180.00 20.00 2020 Unknown Vanadium 1,2,4-Trimethylbenzene 1,2-Dichlorobenzene Xylenes, Total Magnesium Zinc, Total Gross Alpha Radiological Inorganics Water Quality Constituent Odor-Threshold Specific Conductance Potassium Molybdenum pH Hardness (CaCO3) Chloroform Hexavalent Chromium Methylene Chloride Bromodichloromethane Bromoform Calcium N-Nitrosodi-n-butylamine Dibromochloromethane Chloride Boron Total Dissolved Solids Perchlorate Secondary Standards (Aesthetic Standards) Turbidity (b) Sulfate Bicarbonate Alkalinity (HCO3) Additional Constituents (Unregulated) FONTANA WATER COMPANY -CONSUMER CONFIDENCE REPORT- The sources of water provided to Fontana Water Company's customers in 2020 was approximately 60% groundwater, 15% local surface water, and 25% water from the State Water Project. Groundwater is produced from the Chino Basin, Rialto Basin, Lytle Basin, and an unnamed basin. Local surface water from Lytle Creek and imported surface water from the State Water Project are treated at Fontana Water Company's Sandhill Water Treatment Plant. Nitrate (as Nitrogen) Este informe contiene información muy importante sobre su agua potable. All water samples are collected by state-certified employees of the water company. Samples are analyzed by state-certified independent laboratories and the results are forwarded to the State Water Resources Control Board, Division of Drinking Water. The following report provides detailed information about the quality of the water delivered to customers. The water supplied by Fontana Water Company complies with all state and federal safe drinking water standards and regulations. Highest Percentage of Positive Samples CollectedMicrobiological If necessary, speak to someone who understands it for translation. 2.43% -YEAR 2020- Si necesario, hable con alquien que lo entienda para que se lo traduzcan. Total Coliform Bacteria This report contains important information about your drinking water. DETECTED WATER QUALITY CONSTITUENTS - GROUNDWATER Primary Standards Total Organic Carbon Sodium Strontium 1-Butanol Definitions and Footnotes on Page 4 (FWC-CCR 2020)Page 1 Units PHG (MCLG) Level Found Sample Year Likely Source of Detected Constituent NS 0.15 NS 100% of samples≤0.3 NS 0.26 NTU NS 100% of samples≤0.3 Units PHG (MCLG)MCL Sample Year Likely Source of Detected Constituent % (0) 5% (a)2020 Naturally present in the environment ppm 10 10 ND - 0.60 0.30 2020 Runoff and leaching from fertilizer use; leaching from septic tanks and sewage; erosion of natural deposits ppm 1 2 0.14 - 0.16 0.15 2020 Erosion of natural deposits;discharge from fertilizer and aluminum factories ppm NS 500 31.00 - 46.00 38.50 2020 Runoff and leaching from natural deposits; seawater influence units NS 3 1.00 - 2.00 1.13 2020 Naturally-occurring organic materials µmho/cm NS 1,600 370.00 - 420.00 395.00 2020 Substances that form ions when in water; seawater influence ppm NS 500 30.00 - 38.00 34.00 2020 Runoff and leaching from natural deposits; industrial wastes ppm NS 1,000 110.00 - 220.00 165.00 2020 Runoff and leaching from natural deposits ppm NS NS 112.00 - 127.00 119.50 2020 Unknown ppm NS NS 110.00 - 140.00 133.33 2020 Unknown ppb NS NS 79.00 - 130.00 104.50 2020 Unknown ppb NS NS 3.90 - 5.20 4.48 2020 Unknown ppb NS NS 1.30 - 13.00 8.53 2020 Unknown ppb NS NS ND - 6.20 2.46 2020 Unknown ppb NS NS 3.80 - 4.30 4.05 2020 Unknown ppm NS NS 31.80 - 36.40 34.10 2020 Unknown ppb NS NS 3.90 - 15.00 9.06 2020 Unknown ppb NS NS 3.00 - 16.00 7.89 2020 Unknown ppm NS NS 8.00 - 8.73 8.37 2020 Unknown units NS NS 7.90 - 8.06 7.98 2020 Unknown ppm NS NS 2.50 - 2.60 2.55 2020 Unknown ppm NS NS 24.00 - 39.00 31.50 2020 Runoff and leaching from natural deposits ppm NS NS 0.87 - 2.40 1.59 2020 Runoff and leaching from natural deposits ppb NS NS ND - 4.50 2.77 2020 Unknown Units PHG (MCLG) [MRDLG] MCL [MRDL]Range Average Sample Year Likely Source of Detected Constituent ppb NS 80 ND - 51.00 35.00 2020 By-product of drinking water disinfection ppb NS 60 ND - 18.00 13.00 2020 By-product of drinking water disinfection ppm 4 4 0.20 - 1.80 0.72 2020 Drinking water disinfectant added for treatment Units Regulatory Action Level (c) Sample Year 90th Percentile Likely Source of Detected Constituent ppb 15 2018 ND Internal corrosion of household water plumbing systems; discharges from industrial manufacturers; and erosion of natural deposits ppb 1,300 2018 160 Internal corrosion of household water plumbing systems; erosion of natural deposits; leaching from wood preservatives Units Action Level Sample Year Range Average Number of Schools requested Lead Sampling Likely Source of Detected Constituent ppb 15 2018 ND - 12 0.34 44 Internal corrosion of household water plumbing systems; discharges from industrial manufacturers; and erosion of natural deposits Soil runoff2020 Turbidity (b) DETECTED WATER QUALITY CONSTITUENTS - SYSTEM WIDE pH Chloroform TT = 1.0 NTU DETECTED WATER QUALITY CONSTITUENTS - SURFACE WATER Total Organic Carbon Bromofluorobenzene TT = 95% of Samples ≤0.5 Turbidity (b)TT = 1.0 NTU Soil runoff Specific Conductance Water Quality Constituent Primary Standards TT = 95% of Samples ≤0.3Conventional Filtration Total Trihalomethanes Calcium Sodium Highest Percentage of Positive Samples Collected Potassium 0.00% Odor-Threshold Total Coliform Bacteria Chloride Sulfate Disinfectant / Disinfection By-Product Hardness (CaCO3) Secondary Standards (Aesthetic Standards) 1,2-Dichlorobenzene Dibromochloromethane D.E. Filtration Lead 0 Pursuant to Title 22 of the California Code of Regulations, Lead and Copper monitoring for the Fontana Water Company system was completed in 2018 with the collection of 50 samples. The next sampling event will commence in September 2021. In 2018 forty-four schools requested lead sampling. Of the forty-four schools sampled three exceeded the action level of 15 ppb . The three schools were resampled two additional times for confirmation of an exceedance. All comfirmation sample results were below the action level, and no further action was required. Total Dissolved Solids Lead Lead Monitoring for Schools Number Of Samples Exceeding The Action Level Haloacetic Acids Chlorine Residual Lead and Copper Monitoring Bicarbonate Alkalinity (HCO3) Water Quality Constituent 0 Water Quality Constituent Magnesium Additional Constituents (Unregulated) Bromoform Copper Bromodichloromethane Water Quality Constituent Boron Bromofluorobenzene MCL Clarity NTU Microbiological Inorganics Nitrate (as Nitrogen) Floride Definitions and Footnotes on Page 4 (FWC-CCR 2020)Page 2 • • • • • Contaminants that may be present in source water include: Nitrate: Nitrate in drinking water at levels above 10 mg/L is a health risk for infants of less than six months of age. Such nitrate levels in drinking water can interfere with the capacity of the infant's blood to carry oxygen, resulting in a serious illness; symptoms include shortness of breath and blueness of the skin. Nitrate levels above 10 mg/L may also affect the ability of the blood to carry oxygen in other individuals, such as pregnant women and those with certain specific enzyme deficiencies. If you are caring for an infant, or you are pregnant, you should ask advice from your health care provider. Microbial contaminants, such as viruses and bacteria, that may come from sewage treatment plants, septic systems, agricultural livestock operations, and wildlife. Inorganic contaminants, such as salts and metals, that can be naturally-occurring or result from urban stormwater runoff, industrial or domestic wastewater discharges, oil and gas production, mining, or farming. Pesticides and herbicides, that may come from a variety of sources such as agriculture, urban stormwater runoff, and residential uses. Radioactive contaminants, that can be naturally-occurring or be the result of oil and gas production and mining activities. Organic chemical contaminants, including synthetic and volatile organic chemicals, that are by-products of industrial processes and petroleum production, and can also come from gas stations, landfills, urban stormwater runoff, agricultural application, and septic systems. The sources of drinking water (both tap water and bottled water) include rivers, lakes, streams, ponds, reservoirs, springs, and wells. As water travels over the surface of the land or through the ground, it dissolves naturally-occurring minerals and, in some cases, radioactive material, and can pick up substances resulting from the presence of animals or from human activity. If present, elevated levels of lead can cause serious health problems, especially for pregnant women and young children. Lead in drinking water is primarily from materials and components associated with service lines and home plumbing. Fontana Water Company is responsible for providing high quality drinking water, but cannot control the variety of materials used in plumbing components. When your water has been sitting for several hours, you can minimize the potential for lead exposure by flushing your tap for 30 seconds to 2 minutes before using water for drinking or cooking. If you do so, you may wish to collect the flushed water and resuse it for another beneficial purpose, such as watering plants. If you are concerned about lead in your water, you may wish to have your water tested. Information on lead in drinking water, testing methods, and steps you can take to minimize exposure is available from the Safe Drinking Water Hotline or at http://www.epa.gov/lead. Some people may be more vulnerable to contaminants in drinking water than the general population. Immuno-compromisedpersons such as persons with cancer undergoing chemotherapy, persons who have undergone organ transplants, people with HIV/AIDS or other immune system disorders, some elderly, and infants can be particularly at risk from infections. These people should seek advice about drinking water from their health care providers. USEPA/Centers for Disease Control guidelines on appropriate means to lessen the risk of infection by Cryptosporidium and other microbial contaminants are available from the Safe Drinking Water Hotline (1-800-426-4791). THE UNITED STATES ENVIRONMENTAL PROTECTION AGENCY ("USEPA") AND DIVISION OF DRINKING WATER REQUIRE US TO PROVIDE THE FOLLOWING INFORMATION: Drinking water, including bottled water, may reasonably be expected to contain at least small amounts of some contaminants. The presence of contaminants does not necessarily indicate that water poses a health risk. More information about contaminants and potential health effects can be obtained by calling the USEPA's Safe Drinking Water Hotline (1-800-426-4791). In addition to the constituents listed in this report, Fontana Water Company conducted monitoring for over 100 additional constituents and the results show none of those constituents detected in the water. Included in this additional monitoring were constituents for which Division of Drinking Water and USEPA have not yet set standards. The State allows us to monitor for some contaminants less than once per year because the concentrations of these contaminants do not change frequently. Some of our data, though representative, are more than one year old. For more information about water quality or public participation opportunities, contact: Eric Tarango, Water Quality Superintendent at edtarango@fontanawater.com or at (909) 822-2201, or write to Fontana Water Company, Post Office Box 987, Fontana, California 92334. In order to ensure that tap water is safe to drink, the USEPA and the State Water Resources Control Board ("State Water Board") prescribe regulations that limit the amount of certain contaminants in water provided by public water systems. The U.S. Food and Drug Administration regulations and California law also establish limits for contaminants in bottled water that provide the same protection for public health. This Consumer Confidence Report (CCR) reflects changes in drinking water regulatory requirements during 2020. All water systems are required to comply with the state Total Coliform Rule. Beginning April 1, 2016, all water systems are also required to comply with the federal Revised Total Coliform Rule. The new federal rule maintains the purpose to protect public health by ensuring the integrity of the drinking water distribution system and monitoring for the presence of microbials (i.e., total coliform and E. coli bacteria). The U.S. EPA anticipates greater public health protection as the new rule requires water systems that are vulnerable to microbial contamination to identify and fix problems. Water systems that exceed a specified frequency of total coliform occurrences are required to conduct an assessment to determine if any sanitary defects exist. If found, these must be corrected by the water system. Definitions and Footnotes on Page 4 (FWC-CCR 2020)Page 3 Definitions and Footnotes: MCL = MCLG = MRDL = MRDLG = O/S = Out of Service ND = None Detected NS =No Standard NTU = pCi/L = picocuries per Liter PHG = PDWS = ppt = ppb = ppm = parts per million. A ppm is equivalent to 1 second in 11.5 days TT = µmho/cm =micromhos per centimeter ≤ = less than or equal to (a) = (b) = (c) = Maximum Contaminant Level: The highest level of a contaminant that is allowed in drinking water. Primary MCLs are set as close to the PHGs (or MCLGs) as is economically and technologically feasible. Secondary MCLs are set to protect the odor, taste, and appearance of drinking water. Turbidity is a measure of the cloudiness of the water. We monitor it because it is a good indicator of water quality. High turbidity can hinder the effectiveness of disinfectants. Maximum Contaminant Level Goal: The level of a contaminant in drinking water below which there is no known or expected risk to health. MCLGs are set by the USEPA. Maximum Residual Disinfectant Level Goal: The level of a drinking water disinfectant below which there is no known or expected risk to health. Regulatory Action Level: The concentration of a contaminant which, if exceeded, triggers treatment or other requirements that a water system must follow. Primary Drinking Water Standard: MCLs and MRDLs for contaminates that affect health along with their monitoring and reporting requirements, and water treatment requirements. This report along with other important information can be found on the company's website at www.fontanawater.com. Please share this information with all the other people who drink this water, especially those who may not have received this public notice directly (for example, people in apartments, nursing homes, schools, and businesses). You can do this by posting this public notice in a public place or distributing copies by hand or mail. When 40 or more routine samples are collected per month, no more than 5% of the samples may be total coliform positive. Public Health Goal: The level of a contaminant in drinking water below which there is no known or expected risk to health. PHGs are set by the California Environmental Protection Agency. Maximum Residual Disinfectant Level: The highest level of a disinfectant allowed in drinking water. There is convincing evidence that addition of a disinfectant is necessary to control microbial contaminants. Treatment Technique: A required process intended to reduce the level of a contaminant in drinking water. parts per billion. A ppb is equivalent to 1 second in nearly 32 years parts per trillion. A ppt is equivalent to 1 second in nearly 32,000 years Nephelometric Turbidity Units Definitions and Footnotes on Page 4 (FWC-CCR 2020)Page 4 Your Property. Our Priority. 1745 W. Orangewood Avenue, Suite 201, Orange, CA 92868 Telephone (714) 634-9500 Fax: (714) 634-9507 www.HillmannConsulting.com February 9, 2022 State of California Department of Toxic Substances Control Region 4 – Cypress Regional Office 5796 Corporate Avenue Cypress, CA 90630-4732 Phone (714) 484-5337 Fax (714) 484-5318 PubReqAct@dtsc.ca.gov RE: Environmental Files: 14387 Valley Blvd, Fontana, CA 92336 Dear Sir/Madam: Hillmann Consulting, LLC is conducting an environmental investigation of the above referenced property. Under the Freedom of Information Act, we are requesting any information your office has regarding this property. If any records are located, we would like to obtain copies or schedule a file review. If no records are available, please contact me to confirm. Thank you. Sincerely, Gabriela Cyrulik Environmental Specialist Hillmann Consulting, LLC gcyrulik@hillmannconsulting.com Page 1 of 2 CUPA San Bernardino County Fire Protection District • Hazardous Materials Division 620 S. E St., San Bernardino, CA 92415-0153 • (909) 386-8468 FAX (909) 386-8460 REQUEST FOR AN ENVIRONMENTAL AUDIT PHASE 1 CERTIFIED HAZARDOUS MATERIALS RECORDS SEARCH FINDING REPORT The main focus of a REQUEST FOR AN ENVIRONMENTAL AUDIT PHASE 1 CERTIFIED HAZARDOUS MATERIALS RECORDS SEARCH FINDING REPORT is to determine whether there exists in San Bernardino County Fire Protection District (SBCFPD) any record relating to contamination or reports of spills at a particular site. An Environmental Phase 1 Certified Hazardous Materials Records Search Finding Report should reveal whether there are any facilities at the site that are subject to current or past regulatory activity by SBCFPD, such as underground storage tanks, hazardous material handlers, hazardous waste generators, and CalARP facilities, as well as any reports of spills, incidents, complaints, or cleanup activity, which can be a useful tool in providing a history of compliance or non-compliance. Once SBCFPD has completed its records search, an Environmental Phase 1 Certified Hazardous Materials Records Search Finding Report will be prepared and issued. Such report will detail all SBCFPD records associated with a particular site by type, date, location, and status (where applicable). All files identified in an Environmental Phase 1 Certified Hazardous Materials Records Search Finding Report can be made available for copies and/or review upon request. If the completed records search reveals no SBCFPD record of hazardous material activity at the site, an Environmental Phase 1 Certified Hazardous Materials Records Search Finding Report will be issued, noting that “no records” were identified. Please provide a specific site address or location description. If a situs address does not exist or cannot be found, list another type of location identifier such as Assessor Parcel Number (preferable), cross streets or intersections (e.g., NWC 5th Ave. & Main St.), and/or legal description. If possible, please attach a map to this request form. SITE INFORMATION Property Owner or Business Name Location (Site Address and/or Assessor Parcel No.) City/Community Please provide your name, the company you represent, and contact information below. REQUESTOR INFORMATION NAME TITLE (If individual, leave blank) COMPANY (If individual, leave blank) MAILING ADDRESS CITY STATE ZIP CODE TELEPHONE FAX EMAIL ADDRESS So that we may provide better service, please check one or more of the boxes below which best describe how the findings of th e Env. Audit Phase 1 Certified Hazardous Materials Records Search will be used and/or your relationship to the property in question. PURPOSE OR RELATIONSHIP TO PROPERTY 1. Phase I site assessment or due diligence AT THE SITE 7. Owner or operator of the facility or property 2. Environmental professional involved with remediation AT THE SITE 8.Potential buyer 3. Phase I site assessment or due diligence NEARBY 9.Real Estate Agent, Lender, Appraiser 4. Environmental professional involved with remediation NEARBY 10. Pending escrow 5. Proposed School Site (1/4 mi. search for AHM)11. Proposed redevelopment 6. Proposed Drinking Water Well 12. Legal or other reason: ___________________________ AGENCY USE Phase 1 Certified Record Search Finding Report issued: ___/___/___ Reference No: Phase 1 Certified “No Record” Finding Report issued: ___/___/___ Amount Paid: Receipt No.: Date: hazmatrecords@sbcfire.org Page 2 of 2 ** IMPORTANT –THIS PAGE MUST BE SIGNED PRIOR TO SUBMITTAL ** DISCLAIMER: While all attempts are made to provide accurate, current, and reliable information, San Bernardino County Fire Protection District (further referred to as SBDFPD) recognizes the possibility of human error. Therefore, SBCFPD, its officers, employees, agents and volunteers, make no representations as to the accuracy, completeness or suitability of an Environmental Audit Phase 1 Certified Hazardous Materials Records Search Finding Report and provides an Environmental Audit Phase 1 Certified Hazardous Materials Records Search Finding Report “as is,” with no warranties, express or implied, including the implied warranty of fitness for a particular purpose. In no event shall SBCFPD be liable for any damages of any nature whatsoever, arising out of the issuance of a Certified Hazardous Materials Records Search Finding Report. SBCFPD therefore assumes no liability for damages incurred directly or indirectly as a result of any errors, omissions or discrepancies in a Certified Hazardous Materials Records Search Finding Report. RELEASE AND INDEMNIFICATION: In consideration for the issuance of an Environmental Audit Phase 1 Certified Hazardous Materials Records Search Finding Report, I hereby release and forever discharge SBCFPD, its officers, employees, agents and volunteers from any and all claims, actions, losses, damages and/or liability in connection with SBCFPD’s issuance of an Environmental Audit Phase 1 Certified Hazardous Materials Records Search Finding Report, including, but not limited to, claims that may arise due to the active or passive negligence of SBCFPD, its officers, employees, agents and volunteers. I am familiar with the provisions of California Civil Code Section 1542, which provides as follows: "A general release does not extend to claims which the creditor does not know or suspect to exist in his or her favor at the time of executing the release, which if known by him or her must have materially affected his or her settlement with the debtor." I hereby expressly waive any and all rights that I may have there under. I understand and acknowledge the significance and consequence of this specific waiver of California Civil Code Section 1542 and assume full responsibility for any injuries, damages, losses or liabilities that I may hereafter discover as possibly resulting from SBCFPD’s issuance of an Environmental Audit Phase 1 Certified Hazardous Materials Records Search Finding Report. In further consideration for SBCFPD’s issuance of an Environmental Audit Phase 1 Certified Hazardous Materials Records Search Finding Report, I hereby agree, for myself, my heirs, administrators, executors and assigns, that I shall indemnify, defend (with counsel approved by County) and hold harmless SBCFPD, its officers, employees, agents and volunteers from any and all claims, demands, actions or suits arising out of or in connection with SBCFPD’s issuance of an Environmental Audit Phase 1 Certified Hazardous Materials Records Search Finding Report brought by any third party. * * * I have read the above terms and conditions, including the paragraphs entitled “DISCLAIMER” and “RELEASE AND INDEMNIFICATION”, and by my signature below, I affirm that I understand these terms and conditions and accept them as part of my REQUEST FOR AN ENVIRONMENTAL AUDIT PHASE 1 CERTIFIED HAZARDOUS MATERIALS RECORDS SEARCH FINDING REPORT. I hereby request an Environmental Audit Phase 1 Certified Hazardous Materials Records Search Finding Report for the location described on Page 1 of this application. I am including payment of the initial fee of $136.00, for the first hour of research, by check or money order, payable to San Bernardino County Fire Protection District, or by credit card payment taken over the phone. I understand that research exceeding one hour will be billed at the rate of $136.00 for each additional hour spent by SBCFPD in completing this request. I have faxed or emailed this request and will forward payment along with the original request form within 48 hours. REQUESTOR’S SIGNATURE SIGNATURE OF REQUESTOR DATE Rev. 05/06/2020 By signing in or creating an account, some fields will auto-populate with your information and your submitted forms will be saved and accessible to you. The City of Fontana is subject to the California Public Records Act (Government Code Sections 6250-6276.48) and must respond to all records requests in accordance with these statutes. Pursuant to Government Code Section 6253(c), "Each agency, upon a request for a copy of records, shall, within 10 days from receipt of the request, determine whether the request, in whole or in part, seeks copies of disclosable public records in the possession of the agency and shall promptly notify the person making the request of the determination and the reasons therefore." If more than 10 days are needed to determine if your records request will be complied with, you will be notified per Government Code Section 6253(c) advising that an extension is needed. Yes No Would you like to add an attachment?* Public Records Request Form Form Center Select Language ▼ Enter request for a copy of the public records Requestor Contact Information Name* Valerie Murrieta Date* Phone* 7146349500 Email* vmurrieta@hillmannconsulting.com Street Address 1745 W Orangewood Ave, 201 City Orange State CA Zip Code 92868-2004 Copy Fees (Make check payable to City Of Fontana) Electronic copies are provided at no cost Election Filing Forms : $0.10 per page Black & White Photocopies (Using Copier Feeder) : $0.20 for the 1st page and $0.05 per additional page Black & White Photocopies (Manual on Flatbed): $0.20 per page Color Photocopies (Using Copier Feeder) : $0.50 for the 1st page and $0.40 per additional page Color Photocopies (Manual on Flatbed): $0.50 per page Receive an email copy of this form. RE: Environmental Files: 14387 Valley Blvd., Fontana, CA 92335 Dear Sir/Madam: Hillmann Consulting, LLC is conducting an environmental investigation of the above referenced property. We would like to know if any environmental files (UST, groundwater, wells, etc.) exist for this property. If any records are located, we would like to obtain copies or schedule a file review. If no records are available, please contact me to confirm. Thank you. protected by reCAPTCHA Privacy - Terms 02/09/2022 Select Language ▼ Email address vmurrieta@hillmannconsulting.com This field is not part of the form submission. * indicates a required field Fontana City Hall 8353 Sierra Avenue • Fontana, CA 92335 Phone: (909) 350-7600 • Monday – Thursday, 8:00 am - 5:00 pm City of Fontana Mission Statement: We serve to enrich the lives of all people by embracing opportunity Helpful Links Home Contact Us Suggestion/CommentsSelect Language ▼ Your Property. Our Priority. 1745 W. Orangewood Avenue, Suite 201, Orange, CA 92868 Telephone (714) 634-9500 Fax: (714) 634-9507 www.HillmannConsulting.com February 9, 2022 California Regional Water Quality Control Board – Santa Ana Region (8) Underground Storage Tank (UST) File Review Division 3737 Main Street, Suite #500 Riverside, CA 92501-3348 Phone (951) 782-4499 Fax (951) 781-6288 FileReview8@waterboards.ca.gov RE: Environmental Files: 14387 Valley Blvd., Fontana, CA 92335 Dear Sir/Madam: Hillmann Consulting, LLC is conducting an environmental investigation of the above referenced property. We would like to know if any environmental files (UST, groundwater, wells, etc.) exist for this property. If any records are located, we would like to obtain copies or schedule a file review. If no records are available, please contact me to confirm. Thank you. Sincerely, Gabriela Cyrulik Environmental Scientist Hillmann Consulting, LLC gcyrulik@hillmannconsulting.com 2/9/22, 11:32 AM PR - PR Request https://onbase-pub.aqmd.gov/sAppNet/UnityForm.aspx?key=UFKey 1/2 PUBLIC RECORDS REQUEST FORM Request Information (For Office Use Only) Attention Requestor Please fill out this form completely. You may include an attachment to the form, if necessary. Requestor Information Type of Requested Record(s). REQUESTED RECORDS. Please be as specific as possible in describing the records you are seeking. The more specific you are, the easier it will be to determine if such records exist in District files. Please contact the Public Records Unit if you need assistance in identifying District records. Note: Permits to Operate, Equipment Lists, Notices of Violation, Notices to Comply, and Emissions Summaries are available through SCAQMD's FIND page at http://www3.aqmd.gov/webappl/fim/prog/search.aspx (you need to copy and paste this link into your browser). Time Period of Documents Requested Requested Facility or Site Information (if applicable) Note: You may only include one Facility or Site per Form. Requested Application or Permit List. (if applicable) Please click the Add Button to the right to enter a Application/Permit Number Authorization Letter Attachment (0) Authorization Letter Note: Please use the above button for attaching an Authorization Letter from the facility to release confidential information for your public records request. Supplemental Attachments (0) Supplemental Documents Note: Please use the above button for attaching additional documents that will help define your public records request. Also Note: You MUST press the "Submit Your Public Records Request" button to complete this form otherwise the form will be automatically deleted! Date Stored Public Record Request Nbr Time Stored Public Record Request Tracking Nbr119532 Requestor Name Valerie Murrieta Requestor Company Hillmann Consulting, LLC Requestor Email* VMURRIETA@HILLMANNCONSULTING.COM Requestor Phone Requestor Address 1745 W Orangewood Ave, 201 Requestor City Orange Requestor State CA Requestor Zip Code 92868 Please Enter a description of the records you are requesting here:* Permits to Operate, Equipment Lists, Notices of Violation, Notices to Comply, and Emissions Summaries, UST/AST Records, Asbestos Notifications & Records, Complaints Start Date* 1/1/1900 End Date* 2/9/2022 Facility ID (if known) Facility Name (if known) Address 14387 Valley Blvd City Fontana Zip Code 92355 2/9/22, 11:32 AM PR - PR Request https://onbase-pub.aqmd.gov/sAppNet/UnityForm.aspx?key=UFKey 2/2 INSTRUCTIONS FOR REQUESTING RECORDS (California Public Records Act, Govt. Code Sections 6250-6276.48) 1. In order to expedite your request, please fill out the form completely. Requests may also be submitted by phone at (909) 396-3700, by facsimile to(909) 396-3330, or by email to PublicRecordsRequests@aqmd.gov. 2. Requests must be for records prepared, owned, used, or retained by the District (Gov. Code Sec. 6252(e)). Requests should be for clearly identifiablerecords. The District is not required to create a new record in response to a request. The District will assist the requestor in making a request thatdescribes reasonably identifiable records (Gov. Code Sec. 6253.1). Documents will not be provided if disclosure would infringe upon a copyright, tradesecret, or is otherwise exempt in accordance with state law. 3. A search for facility records can only be conducted by one or all of the following: -- a) Facility Name, Address, or Identification Number -- b) Facility Application Number, or Permit to Operate Number; or -- c) Facility Notice of Violation/Notice to Comply Number. 4. You will be notified within ten (10) days whether your request seeks copies of disclosable public records prepared, owned, used, or retained by thisagency. In some cases, the District may need an additional 14 days to respond. If so, you will be notified in writing. You will also be provided an estimateddate of when the records will be made available. 5. Communications regarding your request, and any records, will be provided by email, unless specified otherwise. 6. If the search for records finds the records voluminous, you will be notified of the approximate number of pages and/or length of time it will take toprocess your request. 7. If the records you requested have been marked confidential by the source of the record, you will be notified and given the option of continuing withthe District’s Trade Secret process. 8. If your request is to review records, rather than receive copies, the District will notify you once the records are gathered, and arrangements will bemade for your review. 9. The charge for the direct cost of duplication is as follows: Paper Copies, $0.15/page each over 10 pages (first 10 pages are free); Copied CD’s or flashdrives, no charge; and Copied Audio Tapes, $5.00 each. After a preliminary estimate, advance payment may be required. 10. If the request is for information in an electronic format, the requestor shall bear the cost of producing a copy of the record, including the cost toconstruct the record and the cost of programming and computer services necessary to produce a copy of the record, when either of the following applies: (1) the District would be required to produce a copy of an electronic record and the record is one that is produced only at otherwise regularly scheduledintervals, or (2) the request would require data compilation, extraction, or programming to produce the record. (Gov. Code Sec. 6253.9(b)). The transfer of gathered electronic records onto CD, DVD or flash drive typically costs $10.00 each. An invoice will accompany your records when completed. Note: For further information, please refer to the District’s Guidelines for Implementing the California Public Records Act. The Guidelines are available in the lobby of the District Headquarters or on the District’s web site at www.aqmd.gov. Note: If you have questions pertaining to the submittal of a Public Records Act request, you may contact the Public Records Unit, (909) 396-3700, Tuesday through Friday, 7:00 a.m. to 5:30 p.m. Our Fax number is (909) 396-3330. Our email address is PublicRecordsRequests@aqmd.gov. 2/9/22, 11:29 AM MyProperty https://enviro.epa.gov/enviro/myproperty.certificate?p_addr=14387 Valley Boulevard&p_city=Fontana&p_state=CA&p_ID=dfkk3d9390w 1/1 U.S. Environmental Protecon Agency MyProperty Environmental Databases Search The search of EPA's Facility Registry System did not locate any records for the search criteria provided below: Search Criteria: Street Address:14387 Valley Boulevard City, State:Fontana, CA Query executed on:02/09/2022 02:29 PM EST Contact the appropriate state, tribal or local agencies if you seek additional information. Disclaimer The MyProperty reports are provided solely for informaonal purposes. They do not provide legal advice, have legally binding effect, or expressly or implicitly create, expand, or limit any legal rights, obligaons, responsibilies, expectaons, or benefits in regard to any person. EPA maintains the applicaon to enhance public access to environmental informaon. This service has connual data updates, and we will correct errors brought to our aenon, as appropriate. Hillmann Consulting LLC Phase I Environmental Site Assessment Hillmann Project No.: C3-8909 14387 Valley Boulevard, Fontana, California APPENDIX G PROJECT PERSONNEL QUALIFICATIONS PROFESSIONAL EXPERIENCE: Ms. Cyrulik is an Environmental Technician for our Southern California Office. Ms. Cyrulik has supervised work practices and controls in accordance with job specifications, current EPA, OSHA, and state regulations for asbestos abatement projects in schools, as well as commercial, industrial, public, and multi-family residential buildings. As an Environmental Technician, Ms. Cyrulik performs quality assurance air sampling for asbestos, lead, and mold abatement projects. She is also responsible for performing air and surface hazard materials testing, and potable and non-potable water sampling. She regularly performs Indoor Air Quality Assessments as well for several high-profile clients. Additionally, Ms. Cyrulik is skilled at performing Phase I environmental site assessments and transaction screens to meet environmental due diligence requirements under CERCLA. Representative Experience Includes: Tishman Speyer Properties, nationwide: Hillmann has been providing the complete environmental program for Tishman Speyer’s properties since 1987. Our services include: phase I environmental site assessments, asbestos surveys, air monitoring, bid administration, O&M programs, industrial hygiene, and indoor air quality programs. Ms. Cyrulik functions as an Industrial Hygienist on this contract, which is ongoing, and performs Indoor Air Quality Assessments. Brookfield Properties, various locations: Since 1987, Hillmann has performed industrial hygiene, microbial, indoor air quality, asbestos surveys, project design investigations, project management, bulk sampling and analysis, and geotechnical services in numerous buildings in the New York and Los Angeles metropolitan areas. Ms. Cyrulik is an Industrial Hygienist on this contract. Gabriela Cyrulik Environmental Technician gcyrulik@hillmannconsulting.com EDUCATION: B.S. Geography and Minor in Environmental Science, Montclair State University, Montclair, NJ CERTIFICATIONS: OSHA 10-hr Construction Safety & Health CA DPH Lead Sampling Technician Certified in Fire & Smoke Restoration YEARS OF EXPERIENCE: With Hillmann: 2 years Total: 2 years PROFESSIONAL EXPERIENCE: Mr. Terwilliger is responsible for business operations, fiscal management and field staff management for Hillmann’s California Office. He also performs asbestos surveys and investigations to identify asbestos and lead materials associated with occupational hazards. He supervises work practices and controls in accordance with job specifications, current EPA, OSHA and State Regulations for Asbestos remediation projects in commercial, industrial and multi-family residential buildings. Mr. Terwilliger performs IAQ, mold and moisture investigations in commercial, industrial and residential facilities nationwide. He also performs awareness training for asbestos, lead and microbial agents. Mr. Terwilliger provides litigation support consultation. Representative Experience Includes: Tishman Speyer Properties, Various locations: Hillmann has provided the complete environmental program for Tishman Speyer’s properties since 1987. Our services include environmental health and safety, industrial hygiene, phase I environmental site assessments, asbestos surveys, air monitoring, bid administration, O&M programs and indoor air quality programs on various commercial, industrial and multi-family residential properties. Mr. Terwilliger is an Environmental Scientist on this contract, conducting on-site environmental services including phase I site assessments and NPDES water quality testing. Westfield – Environmental Program, Various locations: Since 2000, Hillmann has been providing an environmental program encompassing environmental health and safety, Phase I environmental site assessments, asbestos and lead surveys, air monitoring, bid administration and O&M programs, industrial hygiene and indoor air quality programs, and hazardous materials assessments on their mall properties throughout the county. Mr. Terwilliger is an Environmental Scientist on this contract performing industrial hygiene services that include indoor air quality monitoring, Phase I environmental site assessments, asbestos and lead surveys. Brookfield Office Properties, Various sites, CA: Hillmann has been providing hazardous materials surveys, development abatement specifications, and managing the oversight activities during the abatement at various Brookfield owned sites throughout California. Mr. Terwilliger functions as a Project Manager for this contract. California Department of Transportation, Central Valley and Northern CA: Hillmann has been performing asbestos and Lead-based Paint Surveys for the California Department of Transportation. Performed comprehensive asbestos containing materials and lead- based paint surveys of residential and commercial buildings that were slated for demolition and generated report of findings in order to aid the Department of Transportation (DOT) in facilitating the road improvement programs and building renovations throughout the J. Ryan Terwilliger Operational Manager, West Coast EDUCATION: B.S. Environmental Science, University of Southern California, Los Angeles, CA CERTIFICATION: Cal-OSHA Certified Asbestos Consultant CDPH Accredited Lead Inspector/Assessor/ Project Monitor CA Certified Site Surveillance Technician OSHA 40 - Hr HAZWOPER YEARS OF EXPERIENCE: With Hillmann: 4 years Total: 8 years Terwilliger, Ryan page 2 Central Valley area. Also during the abatement of asbestos from DOT owned buildings, provided contractor oversight and air monitoring services for regulatory compliance. Verizon, Various Sites, CA. Hillmann conducted hazardous materials surveys, development abatement specifications, and project monitoring during abatement at various Verizon owned sites throughout California. Mr. Terwilliger functioned as the Project Manager. Public Storage, Los Angeles, CA: Hillman preformed comprehensive asbestos, lead-based paint and universal waste materials survey of commercial and industrial buildings throughout Southern California. Hazardous materials surveys were conducted prior to renovation for the storage units. Mr. Terwilliger developed abatement specifications and managed the abatement activities during the renovations of the buildings. He functioned as the Project Manager on this contract.